StarFunc result for job id Q9NT68

User Input

>input (1400 residues)
MDVKDRRHRSLTRGRCGKECRYTSSSLDSEDCRVPTQKSYSSSETLKAYDHDSRMHYGNR
VTDLIHRESDEFPRQGTNFTLAELGICEPSPHRSGYCSDMGILHQGYSLSTGSDADSDTE
GGMSPEHAIRLWGRGIKSRRSSGLSSRENSALTLTDSDNENKSDDENGRPIPPTSSPSLL
PSAQLPSSHNPPPVSCQMPLLDSNTSHQIMDTNPDEEFSPNSYLLRACSGPQQASSSGPP
NHHSQSTLRPPLPPPHNHTLSHHHSSANSLNRNSLTNRRSQIHAPAPAPNDLATTPESVQ
LQDSWVLNSNVPLETRHFLFKTSSGSTPLFSSSSPGYPLTSGTVYTPPPRLLPRNTFSRK
AFKLKKPSKYCSWKCAALSAIAAALLLAILLAYFIAMHLLGLNWQLQPADGHTFNNGIRT
GLPGNDDVATMPSGGKVPWSLKNSSIDSGEAEVGRRVTQEVPPGVFWRSQIHISQPQFLK
FNISLGKDALFGVYIRRGLPPSHAQYDFMERLDGKEKWSVVESPRERRSIQTLVQNEAVF
VQYLDVGLWHLAFYNDGKDKEMVSFNTVVLDSVQDCPRNCHGNGECVSGVCHCFPGFLGA
DCAKAACPVLCSGNGQYSKGTCQCYSGWKGAECDVPMNQCIDPSCGGHGSCIDGNCVCSA
GYKGEHCEEVDCLDPTCSSHGVCVNGECLCSPGWGGLNCELARVQCPDQCSGHGTYLPDT
GLCSCDPNWMGPDCSVEVCSVDCGTHGVCIGGACRCEEGWTGAACDQRVCHPRCIEHGTC
KDGKCECREGWNGEHCTIGRQTAGTETDGCPDLCNGNGRCTLGQNSWQCVCQTGWRGPGC
NVAMETSCADNKDNEGDGLVDCLDPDCCLQSACQNSLLCRGSRDPLDIIQQGQTDWPAVK
SFYDRIKLLAGKDSTHIIPGENPFNSSLVSLIRGQVVTTDGTPLVGVNVSFVKYPKYGYT
ITRQDGTFDLIANGGASLTLHFERAPFMSQERTVWLPWNSFYAMDTLVMKTEENSIPSCD
LSGFVRPDPIIISSPLSTFFSAAPGQNPIVPETQVLHEEIELPGSNVKLRYLSSRTAGYK
SLLKITMTQSTVPLNLIRVHLMVAVEGHLFQKSFQASPNLAYTFIWDKTDAYGQRVYGLS
DAVVSVGFEYETCPSLILWEKRTALLQGFELDPSNLGGWSLDKHHILNVKSGILHKGTGE
NQFLTQQPAIITSIMGNGRRRSISCPSCNGLAEGNKLLAPVALAVGIDGSLYVGDFNYIR
RIFPSRNVTSILELRNKEFKHSNNPAHKYYLAVDPVSGSLYVSDTNSRRIYRVKSLSGTK
DLAGNSEVVAGTGEQCLPFDEARCGDGGKAIDATLMSPRGIAVDKNGLMYFVDATMIRKV
DQNGIISTLLGSNDLTAVRP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:5es4B	0.055	0.092	2.132E-8	674	0.038	0.079	5es4B.pdb.gz	Leukocyte integrin alpha L beta 2 headpiece structures: The alpha I domain, the pocket for the internal ligand, and concerted movements of its loops.
2	PDB:4g1eB	0.055	0.088	9.437E-8	709	0.044	0.086	4g1eB.pdb.gz	AlphaV Beta3 Integrin Crystal Structures and their Functional Implications
3	AFDB:Q8TEP8	0.053	0.031	2.346E-5	2537	0.094	0.052	Q8TEP8.pdb.gz	CE192_HUMAN Centrosomal protein of 192 kDa OS=Homo sapiens OX=9606 GN=CEP192 PE=1 SV=3
4	PDB:7mqaLO	0.070	0.111	9.237E-5	819	0.041	0.071	7mqaLO.pdb.gz	Nucleolar maturation of the human small subunit processome.
5	AFDB:E9Q4Y4	0.058	0.036	1.368E-4	2514	0.094	0.053	E9Q4Y4.pdb.gz	E9Q4Y4_MOUSE Centrosomal protein 192 OS=Mus musculus OX=10090 GN=Cep192 PE=1 SV=1
6	PDB:5iv5BJ	0.070	0.094	1.435E-4	1004	0.028	0.039	5iv5BJ.pdb.gz	Structure of the T4 baseplate and its function in triggering sheath contraction.
7	AFDB:Q54NE5	0.043	0.033	2.125E-4	1918	0.095	0.069	Q54NE5.pdb.gz	Q54NE5_DICDI Abnormal spindle-like microcephaly-associated protein ASH domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0285313 PE=4 SV=1
8	PDB:1h8lA	0.052	0.185	2.230E-4	380	0.010	0.037	1h8lA.pdb.gz	The crystal structure of the inhibitor-complexed carboxypeptidase D domain II and the modeling of regulatory carboxypeptidases.
9	PDB:1nr0A	0.076	0.159	2.356E-4	610	0.042	0.097	1nr0A.pdb.gz
10	PDB:4uybA	0.062	0.202	2.356E-4	401	0.012	0.042	4uybA.pdb.gz
11	PDB:2nsmA	0.053	0.179	2.490E-4	390	0.008	0.028	2nsmA.pdb.gz
12	PDB:4tlgA	0.063	0.208	3.465E-4	396	0.012	0.043	4tlgA.pdb.gz	Crystal structure of SEC14-like protein 4 (SEC14L4)
13	PDB:7zp6A	0.078	0.292	3.662E-4	321	0.021	0.090	7zp6A.pdb.gz
14	AFDB:Q9U489	0.106	0.126	6.052E-4	1147	0.134	0.164	Q9U489.pdb.gz	LIN41_CAEEL Protein lin-41 OS=Caenorhabditis elegans OX=6239 GN=lin-41 PE=1 SV=1
15	AFDB:P23206	0.051	0.095	1.186E-2	674	0.064	0.134	P23206.pdb.gz	COAA1_BOVIN Collagen alpha-1(X) chain OS=Bos taurus OX=9913 GN=COL10A1 PE=2 SV=1
16	AFDB:Q03692	0.050	0.091	1.743E-2	680	0.060	0.124	Q03692.pdb.gz	COAA1_HUMAN Collagen alpha-1(X) chain OS=Homo sapiens OX=9606 GN=COL10A1 PE=1 SV=2
17	AFDB:A0A0G2K7A5	0.050	0.095	2.426E-2	680	0.056	0.115	A0A0G2K7A5.pdb.gz	A0A0G2K7A5_RAT Collagen type X alpha 1 chain OS=Rattus norvegicus OX=10116 GN=Col10a1 PE=4 SV=1
18	AFDB:P27658	0.056	0.095	2.426E-2	744	0.059	0.110	P27658.pdb.gz	CO8A1_HUMAN Collagen alpha-1(VIII) chain OS=Homo sapiens OX=9606 GN=COL8A1 PE=1 SV=2
19	AFDB:P25067	0.056	0.102	3.196E-2	703	0.057	0.114	P25067.pdb.gz	CO8A2_HUMAN Collagen alpha-2(VIII) chain OS=Homo sapiens OX=9606 GN=COL8A2 PE=1 SV=2
20	AFDB:A2RQR3	0.051	0.100	4.699E-2	655	0.051	0.110	A2RQR3.pdb.gz	A2RQR3_DANRE Collagen alpha-1(X) chain precursor OS=Danio rerio OX=7955 GN=wu:fa66d11 PE=4 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	O61307	0.0	823	2731	0.291	0.149	TENM_DROME Teneurin-m OS=Drosophila melanogaster OX=7227 GN=Ten-m PE=1 SV=2
2	Q3UHK6	0.0	1547	2771	0.546	0.276	TEN4_MOUSE Teneurin-4 OS=Mus musculus OX=10090 GN=Tenm4 PE=1 SV=2
3	Q6N022	0.0	1578	2769	0.549	0.278	TEN4_HUMAN Teneurin-4 OS=Homo sapiens OX=9606 GN=TENM4 PE=1 SV=2
4	Q9DER5	0.0	2647	2802	0.939	0.469	TEN2_CHICK Teneurin-2 OS=Gallus gallus OX=9031 GN=TENM2 PE=1 SV=1
5	Q9NT68	0.0	2942	2774	1.000	0.505	TEN2_HUMAN Teneurin-2 OS=Homo sapiens OX=9606 GN=TENM2 PE=1 SV=3
6	Q9P273	0.0	1887	2699	0.655	0.340	TEN3_HUMAN Teneurin-3 OS=Homo sapiens OX=9606 GN=TENM3 PE=1 SV=3
7	Q9R1K2	0.0	2896	2774	0.980	0.495	TEN2_RAT Teneurin-2 OS=Rattus norvegicus OX=10116 GN=Tenm2 PE=1 SV=2
8	Q9UKZ4	0.0	1521	2725	0.549	0.282	TEN1_HUMAN Teneurin-1 OS=Homo sapiens OX=9606 GN=TENM1 PE=1 SV=2
9	Q9VYN8	0.0	769	3004	0.271	0.126	TENA_DROME Teneurin-a OS=Drosophila melanogaster OX=7227 GN=Ten-a PE=1 SV=2
10	Q9W6V6	0.0	1474	2705	0.488	0.252	TEN1_CHICK Teneurin-1 OS=Gallus gallus OX=9031 GN=TENM1 PE=1 SV=1
11	Q9W7R3	0.0	1730	2824	0.613	0.304	TEN4_DANRE Teneurin-4 OS=Danio rerio OX=7955 GN=tenm4 PE=2 SV=1
12	Q9W7R4	0.0	1808	2694	0.626	0.326	TEN3_DANRE Teneurin-3 OS=Danio rerio OX=7955 GN=tenm3 PE=2 SV=2
13	Q9WTS4	0.0	1528	2731	0.548	0.281	TEN1_MOUSE Teneurin-1 OS=Mus musculus OX=10090 GN=Tenm1 PE=1 SV=1
14	Q9WTS5	0.0	2874	2764	0.976	0.494	TEN2_MOUSE Teneurin-2 OS=Mus musculus OX=10090 GN=Tenm2 PE=1 SV=1
15	Q9WTS6	0.0	1897	2715	0.657	0.339	TEN3_MOUSE Teneurin-3 OS=Mus musculus OX=10090 GN=Tenm3 PE=1 SV=1
16	H1ZUX1	5.59e-152	514	2763	0.237	0.120	H1ZUX1_CAEEL EGF-like domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ten-1 PE=1 SV=1
17	G5EGQ6	6.70e-152	513	2684	0.237	0.124	TEN1_CAEEL Teneurin-1 OS=Caenorhabditis elegans OX=6239 GN=ten-1 PE=1 SV=1
18	H1ZUX0	9.18e-152	513	2837	0.237	0.117	H1ZUX0_CAEEL EGF-like domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ten-1 PE=1 SV=1
19	A0A8I6ARC1	1.88e-52	206	2202	0.079	0.050	A0A8I6ARC1_RAT Tenascin C OS=Rattus norvegicus OX=10116 GN=Tnc PE=1 SV=1
20	A0A0G2K1L0	2.88e-52	205	2110	0.079	0.052	A0A0G2K1L0_RAT Tenascin C OS=Rattus norvegicus OX=10116 GN=Tnc PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13715 CarbopepD_reg_2	6.6	18.1	CarboxypepD_reg-like domain
2	PF13620 CarboxypepD_reg	0.9	21.2	Carboxypeptidase regulatory-like domain
3	PF00008 EGF	34	16.2	EGF-like domain
4	PF07974 EGF_2	5.2e-24	95.6	EGF-like domain
5	PF18720 EGF_Tenascin	3.6	19.0	Tenascin EGF domain
6	PF12661 hEGF	7.2e+02	12.3	Human growth factor-like EGF
7	PF18372 I-EGF_1	4.3	18.7	Integrin beta epidermal growth factor like domain 1
8	PF01436 NHL	27	16.2	NHL repeat
9	PF06484 Ten_N	2.5e-176	598.4	Teneurin Intracellular Region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000429430

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000340688	0.999	Adhesion G protein-coupled receptor L1
2	9606.ENSP00000422533	0.998	Adhesion G protein-coupled receptor L3
3	9606.ENSP00000322270	0.980	Adhesion G protein-coupled receptor L2
4	9606.ENSP00000282928	0.841	Zinc finger protein ZIC 1
5	9606.ENSP00000380762	0.738	CST complex subunit TEN1
6	9606.ENSP00000359778	0.592	Adhesion G protein-coupled receptor L4
7	9606.ENSP00000360858	0.537	Noelin
8	9606.ENSP00000381097	0.528	Ephrin type-B receptor 1
9	9606.ENSP00000368872	0.504	Protein inscuteable homolog
10	9606.ENSP00000362109	0.503	Fibroblast growth factor receptor substrate 3
11	9606.ENSP00000367292	0.503	Leucine-rich repeat transmembrane protein FLRT3
12	9606.ENSP00000251921	0.502	NXPE family member 1
13	9606.ENSP00000451648	0.501	Neurexin-3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0042802	0.994	identical protein binding
GO:0046983	0.976	protein dimerization activity
GO:0046982	0.783	protein heterodimerization activity
GO:0005102	0.732	signaling receptor binding
GO:0042803	0.713	protein homodimerization activity
GO:0050839	0.669	cell adhesion molecule binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.976	cellular process
GO:0007155	0.970	cell adhesion
GO:0050794	0.955	regulation of cellular process
GO:0098609	0.941	cell-cell adhesion
GO:0032502	0.923	developmental process
GO:0007275	0.910	multicellular organism development
GO:0098742	0.859	cell-cell adhesion via plasma-membrane adhesion molecules
GO:0048731	0.778	system development
GO:0007399	0.764	nervous system development
GO:0007157	0.662	heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules
GO:0009653	0.600	anatomical structure morphogenesis
GO:0050896	0.408	response to stimulus
GO:0051716	0.323	cellular response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.998	plasma membrane
GO:0030054	0.652	cell junction
GO:0005622	0.554	intracellular anatomical structure
GO:0043226	0.327	organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]