StarFunc result for job id Q9NT99

User Input

>input (713 residues)
MARARGSPCPPLPPGRMSWPHGALLFLWLFSPPLGAGGGGVAVTSAAGGGSPPATSCPVA
CSCSNQASRVICTRRDLAEVPASIPVNTRYLNLQENGIQVIRTDTFKHLRHLEILQLSKN
LVRKIEVGAFNGLPSLNTLELFDNRLTTVPTQAFEYLSKLRELWLRNNPIESIPSYAFNR
VPSLRRLDLGELKRLEYISEAAFEGLVNLRYLNLGMCNLKDIPNLTALVRLEELELSGNR
LDLIRPGSFQGLTSLRKLWLMHAQVATIERNAFDDLKSLEELNLSHNNLMSLPHDLFTPL
HRLERVHLNHNPWHCNCDVLWLSWWLKETVPSNTTCCARCHAPAGLKGRYIGELDQSHFT
CYAPVIVEPPTDLNVTEGMAAELKCRTGTSMTSVNWLTPNGTLMTHGSYRVRISVLHDGT
LNFTNVTVQDTGQYTCMVTNSAGNTTASATLNVSAVDPVAAGGTGSGGGGPGGSGGVGGG
SGGYTYFTTVTVETLETQPGEEALQPRGTEKEPPGPTTDGVWGGGRPGDAAGPASSSTTA
PAPRSSRPTEKAFTVPITDVTENALKDLDDVMKTTKIIIGCFVAITFMAAVMLVAFYKLR
KQHQLHKHHGPTRTVEIINVEDELPAASAVSVAAAAAVASGGGVGGDSHLALPALERDHL
NHHHYVAAAFKAHYSSNPSGGGCGGKGPPGLNSIHEPLLFKSGSKENVQETQI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NT99	1.000	1.000	0.000	713	1.000	1.000	Q9NT99.pdb.gz	LRC4B_HUMAN Leucine-rich repeat-containing protein 4B OS=Homo sapiens OX=9606 GN=LRRC4B PE=2 SV=3
2	AFDB:Q503I7	0.621	0.682	1.098E-72	647	0.589	0.649	Q503I7.pdb.gz	Q503I7_DANRE Leucine rich repeat containing 4C isoform X1 OS=Danio rerio OX=7955 GN=zgc:110565 PE=1 SV=1
3	AFDB:Q8C031	0.608	0.674	2.267E-72	640	0.569	0.634	Q8C031.pdb.gz	LRC4C_MOUSE Leucine-rich repeat-containing protein 4C OS=Mus musculus OX=10090 GN=Lrrc4c PE=1 SV=2
4	AFDB:Q9HBW1	0.604	0.656	2.355E-67	653	0.525	0.573	Q9HBW1.pdb.gz	LRRC4_HUMAN Leucine-rich repeat-containing protein 4 OS=Homo sapiens OX=9606 GN=LRRC4 PE=1 SV=2
5	AFDB:A0A2R8RXX2	0.595	0.665	5.566E-62	635	0.464	0.521	A0A2R8RXX2.pdb.gz
6	AFDB:E9QDQ3	0.609	0.510	7.439E-62	858	0.475	0.395	E9QDQ3.pdb.gz	E9QDQ3_DANRE Leucine-rich repeat-containing 4.1 OS=Danio rerio OX=7955 GN=lrrc4.1 PE=4 SV=2
7	AFDB:A0A286YAB9	0.293	0.322	3.406E-29	628	0.216	0.245	A0A286YAB9.pdb.gz
8	AFDB:Q3URE9	0.293	0.332	6.701E-29	606	0.229	0.269	Q3URE9.pdb.gz	LIGO2_MOUSE Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 2 OS=Mus musculus OX=10090 GN=Lingo2 PE=2 SV=1
9	AFDB:Q96FE5	0.302	0.341	8.955E-29	620	0.231	0.266	Q96FE5.pdb.gz	LIGO1_HUMAN Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1 OS=Homo sapiens OX=9606 GN=LINGO1 PE=1 SV=2
10	AFDB:Q66HV9	0.296	0.332	1.318E-28	622	0.222	0.254	Q66HV9.pdb.gz	LIG1B_DANRE Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1-B OS=Danio rerio OX=7955 GN=lingo1b PE=1 SV=1
11	PDB:1xcdA	0.353	0.795	2.611E-11	305	0.115	0.269	1xcdA.pdb.gz
12	PDB:3t6qA	0.336	0.393	3.662E-11	601	0.108	0.128	3t6qA.pdb.gz	Crystal Structures of Mouse and Human RP105/MD-1 Complexes Reveal Unique Dimer Organization of the Toll-Like Receptor Family.
13	PDB:7wv3A	0.342	0.363	4.034E-11	668	0.123	0.132	7wv3A.pdb.gz	TLR3 forms a highly organized cluster when bound to a poly(I:C) RNA ligand.
14	PDB:2ft3F	0.348	0.788	1.168E-10	305	0.123	0.289	2ft3F.pdb.gz
15	PDB:3b2dA	0.312	0.362	1.561E-10	601	0.111	0.131	3b2dA.pdb.gz	Crystal Structures of Mouse and Human RP105/MD-1 Complexes Reveal Unique Dimer Organization of the Toll-Like Receptor Family.
16	PDB:5y31B	0.137	0.187	3.551E-10	511	0.095	0.133	5y31B.pdb.gz	Structural basis of epilepsy-related ligand-receptor complex LGI1-ADAM22.
17	PDB:6gffI	0.295	0.373	4.383E-9	551	0.105	0.136	6gffI.pdb.gz
18	PDB:6hkwA	0.314	0.705	1.467E-8	306	0.094	0.219	6hkwA.pdb.gz
19	PDB:5yq5B	0.288	0.627	2.058E-8	306	0.109	0.255	5yq5B.pdb.gz
20	PDB:7tvfD	0.273	0.362	2.058E-8	515	0.087	0.120	7tvfD.pdb.gz	Structure of the SHOC2-MRAS-PP1C complex provides insights into RAF activation and Noonan syndrome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9QDQ3	0.0	642	858	0.481	0.400	E9QDQ3_DANRE Leucine-rich repeat-containing 4.1 OS=Danio rerio OX=7955 GN=lrrc4.1 PE=4 SV=2
2	P0C192	0.0	1386	709	0.961	0.966	LRC4B_MOUSE Leucine-rich repeat-containing protein 4B OS=Mus musculus OX=10090 GN=Lrrc4b PE=1 SV=1
3	P0CC10	0.0	1382	709	0.958	0.963	LRC4B_RAT Leucine-rich repeat-containing protein 4B OS=Rattus norvegicus OX=10116 GN=Lrrc4b PE=1 SV=1
4	Q45R42	0.0	701	652	0.523	0.572	LRRC4_RAT Leucine-rich repeat-containing protein 4 OS=Rattus norvegicus OX=10116 GN=Lrrc4 PE=1 SV=1
5	Q503I7	0.0	834	647	0.592	0.652	Q503I7_DANRE Leucine rich repeat containing 4C isoform X1 OS=Danio rerio OX=7955 GN=zgc:110565 PE=1 SV=1
6	Q8C031	0.0	827	640	0.569	0.634	LRC4C_MOUSE Leucine-rich repeat-containing protein 4C OS=Mus musculus OX=10090 GN=Lrrc4c PE=1 SV=2
7	Q99PH1	0.0	701	652	0.523	0.572	LRRC4_MOUSE Leucine-rich repeat-containing protein 4 OS=Mus musculus OX=10090 GN=Lrrc4 PE=1 SV=2
8	Q9HBW1	0.0	708	653	0.526	0.574	LRRC4_HUMAN Leucine-rich repeat-containing protein 4 OS=Homo sapiens OX=9606 GN=LRRC4 PE=1 SV=2
9	Q9HCJ2	0.0	828	640	0.571	0.636	LRC4C_HUMAN Leucine-rich repeat-containing protein 4C OS=Homo sapiens OX=9606 GN=LRRC4C PE=1 SV=1
10	Q9NT99	0.0	1464	713	1.000	1.000	LRC4B_HUMAN Leucine-rich repeat-containing protein 4B OS=Homo sapiens OX=9606 GN=LRRC4B PE=2 SV=3
11	Q96FE5	2.97e-48	182	620	0.212	0.244	LIGO1_HUMAN Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1 OS=Homo sapiens OX=9606 GN=LINGO1 PE=1 SV=2
12	Q9D1T0	1.30e-47	180	614	0.212	0.246	LIGO1_MOUSE Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1 OS=Mus musculus OX=10090 GN=Lingo1 PE=1 SV=1
13	Q3URE9	2.43e-47	179	606	0.212	0.249	LIGO2_MOUSE Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 2 OS=Mus musculus OX=10090 GN=Lingo2 PE=2 SV=1
14	Q6PJG9	9.57e-39	154	635	0.199	0.224	LRFN4_HUMAN Leucine-rich repeat and fibronectin type-III domain-containing protein 4 OS=Homo sapiens OX=9606 GN=LRFN4 PE=1 SV=1
15	Q66HV9	9.89e-38	151	622	0.165	0.190	LIG1B_DANRE Leucine-rich repeat and immunoglobulin-like domain-containing nogo receptor-interacting protein 1-B OS=Danio rerio OX=7955 GN=lingo1b PE=1 SV=1
16	Q149C3	1.90e-37	150	593	0.199	0.239	LIGO4_MOUSE Leucine-rich repeat and immunoglobulin-like domain containing-NOGO receptor-interacting protein 4 OS=Mus musculus OX=10090 GN=Lingo4 PE=2 SV=2
17	Q8BXA0	3.36e-37	150	719	0.170	0.168	LRFN5_MOUSE Leucine-rich repeat and fibronectin type-III domain-containing protein 5 OS=Mus musculus OX=10090 GN=Lrfn5 PE=1 SV=1
18	D4A1J9	4.18e-37	150	719	0.174	0.172	LRFN5_RAT Leucine-rich repeat and fibronectin type-III domain-containing protein 5 OS=Rattus norvegicus OX=10116 GN=Lrfn5 PE=1 SV=1
19	Q2WF71	2.35e-36	148	766	0.178	0.166	LRFN1_MOUSE Leucine-rich repeat and fibronectin type III domain-containing protein 1 OS=Mus musculus OX=10090 GN=Lrfn1 PE=1 SV=1
20	D4ABX8	2.61e-36	147	636	0.189	0.212	LRFN4_RAT Leucine-rich repeat and fibronectin type-III domain-containing protein 4 OS=Rattus norvegicus OX=10116 GN=Lrfn4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07679 I-set	2.1e-12	58.2	Immunoglobulin I-set domain
2	PF00047 ig	1.9e-06	39.3	Immunoglobulin domain
3	PF13895 Ig_2	0.086	24.5	Immunoglobulin domain
4	PF13927 Ig_3	1.5e-08	46.4	Immunoglobulin domain
5	PF01462 LRRNT	0.02	25.8	Leucine rich repeat N-terminal domain
6	PF00560 LRR_1	0.31	22.5	Leucine Rich Repeat
7	PF12799 LRR_4	8.3e-22	88.1	Leucine Rich repeats (2 copies)
8	PF13306 LRR_5	1.3e-17	75.4	BspA type Leucine rich repeat region (6 copies)
9	PF13855 LRR_8	1e-48	174.2	Leucine rich repeat
10	PF14580 LRR_9	6.9e-05	34.0	Leucine-rich repeat
11	PF07686 V-set	0.0047	28.5	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000471502

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000349932	0.996	Receptor-type tyrosine-protein phosphatase S
2	9606.ENSP00000382428	0.965	Disks large homolog 4
3	9606.ENSP00000353030	0.955	Receptor-type tyrosine-protein phosphatase F
4	9606.ENSP00000359085	0.889	Netrin-G1
5	9606.ENSP00000370593	0.871	Receptor-type tyrosine-protein phosphatase delta
6	9606.ENSP00000376921	0.846	Netrin-G2
7	9606.ENSP00000346839	0.770	Fibronectin type III domain containing
8	9606.ENSP00000265459	0.750	Neurexin-2
9	9606.ENSP00000368278	0.684	Interleukin-1 receptor accessory protein-like 1
10	9606.ENSP00000385142	0.656	Neurexin-1
11	9606.ENSP00000314807	0.635	Interleukin 1 receptor accessory protein
12	9606.ENSP00000451648	0.624	Neurexin-3
13	9606.ENSP00000481244	0.622	Phospholemman
14	9606.ENSP00000305288	0.619	Neuroligin-2
15	9606.ENSP00000261745	0.609	N-alpha-acetyltransferase 25, NatB auxiliary subunit
16	9606.ENSP00000392500	0.583	Neuroligin-1
17	9606.ENSP00000362340	0.573	Neurochondrin
18	9606.ENSP00000335614	0.568	Liprin-alpha-3
19	9606.ENSP00000345436	0.562	Caskin-1
20	9606.ENSP00000368994	0.553	Rho GTPase-activating protein 44

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005102	0.993	signaling receptor binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0009987	0.989	cellular process
GO:0051128	0.987	regulation of cellular component organization
GO:0051963	0.980	regulation of synapse assembly
GO:0016043	0.859	cellular component organization
GO:0051239	0.813	regulation of multicellular organismal process
GO:0048518	0.773	positive regulation of biological process
GO:0048522	0.764	positive regulation of cellular process
GO:1901890	0.725	positive regulation of cell junction assembly
GO:0007155	0.697	cell adhesion
GO:0051962	0.695	positive regulation of nervous system development
GO:0098609	0.549	cell-cell adhesion
GO:0051965	0.548	positive regulation of synapse assembly
GO:0098742	0.421	cell-cell adhesion via plasma-membrane adhesion molecules
GO:0032501	0.388	multicellular organismal process
GO:0050808	0.371	synapse organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071944	0.999	cell periphery
GO:0016020	0.999	membrane
GO:0043226	0.995	organelle
GO:0005886	0.992	plasma membrane
GO:0030054	0.722	cell junction
GO:0005622	0.664	intracellular anatomical structure
GO:0045202	0.489	synapse
GO:0098978	0.470	glutamatergic synapse
GO:0098794	0.464	postsynapse
GO:0099572	0.436	postsynaptic specialization
GO:0042995	0.426	cell projection
GO:0098984	0.423	neuron to neuron synapse
GO:0098590	0.409	plasma membrane region
GO:0032279	0.367	asymmetric synapse
GO:0120025	0.365	plasma membrane bounded cell projection
GO:0043227	0.344	membrane-bounded organelle
GO:0099634	0.344	postsynaptic specialization membrane
GO:0014069	0.310	postsynaptic density
GO:0098839	0.304	postsynaptic density membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]