StarFunc result for job id Q9NTG1

User Input

>input (2253 residues)
MRPGPALLLLGVGLSLSVGRLPLPPVPRGAQAAVSGAPGGLLRGAPGLGVRGGRALLSLR
PSAVRAGGAVLSGRGSLCFPHGGTGRRWYCLDLRVLLSAQRLPWPAAPALALVDLQLSAR
GGRLSLTWSVRLPRSPGRLAWAFRLRLLGPGAARPASPAARVSPRSAAPGPRPQQGFVAR
TECPTDGPARVMLQAVNSSSHRAVESSVSCQINACVIQRVRINTDQKGAPVRLSMQAEAT
INASVQLDCPAARAIAQYWQVFSVPAVGQAPDWTQPLDLPQLEIRNSPLFIHIPNNSLQW
GVYVFNFTVSITTGNPKMPEVKDSDAVYVWIVRSSLQAVMLGDANITANFTEQLILDGST
SSDPDADSPLQGLQFFWYCTTDPRNYGGDRIILGSKEVCHPEQANLKWPWASGPVLTLLP
ETLKGDHVYFFRMVIRKDSRTAFSDKRVHVLQGPKAIAHITCIENCERNFIVSDRFSLFL
NCTNCASRDFYKWSILSSSGGEMLFDWMGETVTGRNGAYLSIKAFAFRHFLEAEFSISLY
LACWSGVTSVFRHSFIINHGPQIGECKINPAKGIALITKFVVQCSNFRDKHVPLTYKIIV
SDLHSVGEISSVKENTLGTILYLGPQSTVPPSFLPVGMLASQYGLKIYAQVYDSLGAFSQ
VTLHATAQAPTDKNSSKTVLNQLLSFTVGPSSLLSTLIQKKDFLPAGYLLYIVASVLNNM
KTELPLRDDRVNLRKHLIDQSFLLPVSTLVEIGQVVMTITKLTQKPSEFTWDAQKRATMR
VWQANQALQEYQQKDKRFRSEQIEIVSTGILMSLSNILKMTSPHQVVKDPFYVIESLSDT
ILANKVPGNKTTSMRTPNFNMYVKKVEKWGINQLFRNEKHCRNCFYPTLNVSSVPGLSAN
GPISTMFCDFTNDLFPWLNDQENTSVEVSGFRMTGVADNGSVLEITPDVAEVYLVRKNLT
FAAFNLTVGPNSEVDGSLKKTTGGFSFQVDSTVLREVLVHIVTEVMVLFTVLVYTGSQIT
PTALVATFLVPHDIPPFASQSALFDPACTVKKARVVCLPVSLLQLIAQHSHSPHCTVSIV
LQAPRFVMKLNDKLVRISIFSVQCLDMYGIQSEWREGYCILGEKTSWYEVHCICKNVVRA
RRQLGTIGLTGIHLHTHYVMAKVIVIPNPVDLRLNIIKSLHQNPVTLFTVLFIILLYVGL
AFWALYRDEMDQHLRGHVIVLPDNDPYDNLCYLVTIFTGSRWGSGTRANVFVQLRGTVST
SDVHCLSHPHFTTLYRGSINTFLLTTKSDLGDIHSIRVWHNNEGRSPSWYLSRIKVENLF
SRHIWLFICQKWLSVDTTLDRTFHVTHPDERLTRKDFFFIDVSSNLRKNHMWFSIFASVV
AKTFNRLQRLSCCLAMLLSSLLCNIMFFNLNRQEQTESRERKYMRSMMIGIESVLITIPV
QLLITFLFTCSQRKPQADLKEVSPQKHPLMSEASEHWEEYLRKWHAYETAKVHPREVAKP
ASKGKPRLPKASPKATSKPKHRHRKAQIKTPETLGPNTNSNNNIEDDQDVHSEQHPSQKD
LQQLKKKPRIVLPWWCVYVAWFLVFATSSISSFFIVFYGLTYGYDKSIEWLFASFCSFCQ
SVLLVQPSKIILLSGFRTNKPKYCKNLSWSTKYKYTEIRLDGMRMHPEEMQRIHDQIVRI
RGTRMYQPLTEDEIRIFKRKKRIKRRALLFLSYILTHFIFLALLLILIVLLRHTDCFYYN
QFIRDRFSMDLATVTKLEDIYRWLNSVLLPLLHNDLNPTFLPESSSKILGLPLMRQVRAK
SSEKMCLPAEKFVQNSIRREIHCHPKYGIDPEDTKNYSGFWNEVDKQAIDESTNGFTYKP
QGTQWLYYSYGLLHTYGSGGYALYFFPEQQRFNSTLRLKELQESNWLDEKTWAVVLELTT
FNPDINLFCSISVIFEVSQLGVVNTSISLHSFSLADFDRKASAEIYLYVAILIFFLAYVV
DEGCIIMQERASYVRSVYNLLNFALKCIFTVLIVLFLRKHFLATGIIRFYLSNPEDFIPF
HAVSQVDHIMRIILGFLLFLTILKTLRYSRFFYDVRLAQRAIQAALPGICHMAFVVSVYF
FVYMAFGYLVFGQHEWNYSNLIHSTQTVFSYCVSAFQNTEFSNNRILGVLFLSSFMLVMI
CVLINLFQAVILSAYEEMKQPVYEEPSDEVEAMTYLCRKLRTMFSFLTSQSKAKDEPEFF
IDMLYGQPEKNSHRYLGLKTRNINGKKMVYLVV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NTG1	1.000	1.000	0.000	2253	1.000	1.000	Q9NTG1.pdb.gz	PKDRE_HUMAN Polycystin family receptor for egg jelly OS=Homo sapiens OX=9606 GN=PKDREJ PE=2 SV=2
2	AFDB:Q9Z0T6	0.565	0.596	0.000	2126	0.589	0.624	Q9Z0T6.pdb.gz	PKDRE_MOUSE Polycystin family receptor for egg jelly OS=Mus musculus OX=10090 GN=Pkdrej PE=2 SV=1
3	AFDB:Q8R526	0.306	0.271	2.096E-70	2615	0.162	0.140	Q8R526.pdb.gz	PK1L1_MOUSE Polycystin-1-like protein 1 OS=Mus musculus OX=10090 GN=Pkd1l1 PE=1 SV=2
4	AFDB:F2VYA1	0.203	0.454	1.110E-21	970	0.061	0.141	F2VYA1.pdb.gz	F2VYA1_PIG Polycystin 2, transient receptor potential cation channel OS=Sus scrofa OX=9823 GN=PKD2 PE=2 SV=1
5	AFDB:D4A5F1	0.198	0.448	4.240E-21	966	0.063	0.146	D4A5F1.pdb.gz	D4A5F1_RAT Polycystin 2, transient receptor potential cation channel OS=Rattus norvegicus OX=10116 GN=Pkd2 PE=1 SV=1
6	AFDB:H2LRU7	0.203	0.489	1.049E-20	901	0.061	0.153	H2LRU7.pdb.gz	PKD2_ORYLA Polycystin-2 OS=Oryzias latipes OX=8090 GN=pkd2 PE=1 SV=2
7	AFDB:Q9U1S7	0.201	0.600	3.560E-20	716	0.051	0.162	Q9U1S7.pdb.gz	PKD2_CAEEL Polycystin-2 OS=Caenorhabditis elegans OX=6239 GN=pkd-2 PE=1 SV=3
8	AFDB:Q9NZM6	0.209	0.715	4.880E-20	624	0.046	0.167	Q9NZM6.pdb.gz	PK2L2_HUMAN Polycystin-2-like protein 2 OS=Homo sapiens OX=9606 GN=PKD2L2 PE=2 SV=2
9	AFDB:A2A259	0.204	0.584	1.359E-19	760	0.055	0.164	A2A259.pdb.gz	PK2L1_MOUSE Polycystin-2-like protein 1 OS=Mus musculus OX=10090 GN=Pkd2l1 PE=1 SV=1
10	AFDB:Q8T8Z2	0.204	0.592	2.612E-18	736	0.047	0.145	Q8T8Z2.pdb.gz	Q8T8Z2_DROME AT14535p OS=Drosophila melanogaster OX=7227 GN=brv2 PE=2 SV=1
11	PDB:5mkfA	0.185	0.808	6.593E-13	481	0.048	0.225	5mkfA.pdb.gz	Molecular insights into lipid-assisted Ca(2+) regulation of the TRP channel Polycystin-2.
12	PDB:6du8A	0.174	0.871	3.884E-12	421	0.044	0.238	6du8A.pdb.gz
13	PDB:4rtdA	0.054	0.085	1.378E-9	1122	0.043	0.086	4rtdA.pdb.gz
14	PDB:7q1yA	0.058	0.081	2.865E-8	1374	0.044	0.072	7q1yA.pdb.gz
15	PDB:4lnvA	0.062	0.098	4.084E-8	1276	0.046	0.082	4lnvA.pdb.gz
16	PDB:5a42A	0.068	0.084	4.973E-8	1597	0.044	0.062	5a42A.pdb.gz
17	PDB:7nycA	0.057	0.071	5.381E-8	1542	0.059	0.087	7nycA.pdb.gz	Structural basis of soluble membrane attack complex packaging for clearance.
18	PDB:7q5zA	0.056	0.085	2.223E-7	1344	0.049	0.083	7q5zA.pdb.gz
19	PDB:4aq1A	0.044	0.109	5.291E-7	721	0.022	0.069	4aq1A.pdb.gz	Sbsb Structure and Lattice Reconstruction Unveil Ca21 Triggered S-Layer Assembly
20	PDB:1e07A	0.065	0.172	1.362E-6	642	0.022	0.078	1e07A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9NTG1	0.0	4679	2253	1.000	1.000	PKDRE_HUMAN Polycystin family receptor for egg jelly OS=Homo sapiens OX=9606 GN=PKDREJ PE=2 SV=2
2	Q9Z0T6	0.0	2709	2126	0.585	0.620	PKDRE_MOUSE Polycystin family receptor for egg jelly OS=Mus musculus OX=10090 GN=Pkdrej PE=2 SV=1
3	Q2EG98	8.27e-47	189	2201	0.048	0.050	PK1L3_MOUSE Polycystin-1-like protein 3 OS=Mus musculus OX=10090 GN=Pkd1l3 PE=1 SV=2
4	Q7Z443	6.50e-46	185	1732	0.051	0.066	PK1L3_HUMAN Polycystin-1-like protein 3 OS=Homo sapiens OX=9606 GN=PKD1L3 PE=1 SV=1
5	Q8TDX9	9.67e-36	152	2849	0.094	0.074	PK1L1_HUMAN Polycystin-1-like protein 1 OS=Homo sapiens OX=9606 GN=PKD1L1 PE=1 SV=1
6	E7FKV8	3.64e-35	150	2742	0.090	0.074	PK1L1_ORYLA Polycystin-1-like protein 1 OS=Oryzias latipes OX=8090 GN=pkd1l1 PE=1 SV=2
7	A0A8I6AC84	1.20e-33	145	4254	0.098	0.052	A0A8I6AC84_RAT Polycystin 1, transient receptor potential channel interacting OS=Rattus norvegicus OX=10116 GN=Pkd1 PE=3 SV=1
8	Q6IVV8	4.31e-30	132	904	0.057	0.143	PKD2_DANRE Polycystin-2 OS=Danio rerio OX=7955 GN=pkd2 PE=1 SV=1
9	Q8R526	1.10e-27	126	2615	0.084	0.073	PK1L1_MOUSE Polycystin-1-like protein 1 OS=Mus musculus OX=10090 GN=Pkd1l1 PE=1 SV=2
10	H2LRU7	9.88e-27	122	901	0.059	0.149	PKD2_ORYLA Polycystin-2 OS=Oryzias latipes OX=8090 GN=pkd2 PE=1 SV=2
11	F2VYA1	1.19e-26	121	970	0.056	0.130	F2VYA1_PIG Polycystin 2, transient receptor potential cation channel OS=Sus scrofa OX=9823 GN=PKD2 PE=2 SV=1
12	O35245	1.88e-26	121	966	0.055	0.129	PKD2_MOUSE Polycystin-2 OS=Mus musculus OX=10090 GN=Pkd2 PE=1 SV=2
13	A2A259	7.00e-26	119	760	0.052	0.154	PK2L1_MOUSE Polycystin-2-like protein 1 OS=Mus musculus OX=10090 GN=Pkd2l1 PE=1 SV=1
14	Q9U1S7	1.37e-25	117	716	0.057	0.179	PKD2_CAEEL Polycystin-2 OS=Caenorhabditis elegans OX=6239 GN=pkd-2 PE=1 SV=3
15	Q13563	3.58e-25	117	968	0.053	0.123	PKD2_HUMAN Polycystin-2 OS=Homo sapiens OX=9606 GN=PKD2 PE=1 SV=3
16	Q9P0L9	4.17e-25	116	805	0.049	0.138	PK2L1_HUMAN Polycystin-2-like protein 1 OS=Homo sapiens OX=9606 GN=PKD2L1 PE=1 SV=1
17	D4A5F1	5.04e-24	113	966	0.051	0.119	D4A5F1_RAT Polycystin 2, transient receptor potential cation channel OS=Rattus norvegicus OX=10116 GN=Pkd2 PE=1 SV=1
18	P98161	3.81e-18	94.7	4303	0.034	0.018	PKD1_HUMAN Polycystin-1 OS=Homo sapiens OX=9606 GN=PKD1 PE=1 SV=3
19	Q9VK95	2.73e-17	91.3	924	0.048	0.117	Q9VK95_DROME MIP30126p OS=Drosophila melanogaster OX=7227 GN=Pkd2 PE=2 SV=2
20	O08852	8.07e-17	90.5	4293	0.035	0.018	PKD1_MOUSE Polycystin-1 OS=Mus musculus OX=10090 GN=Pkd1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12296 HsbA	2.2e+02	13.7	Hydrophobic surface binding protein A
2	PF00520 Ion_trans	0.00088	30.1	Ion transport protein
3	PF08016 PKD_channel	7.2e-71	249.7	Polycystin cation channel
4	PF01477 PLAT	2.7e-18	78.0	PLAT/LH2 domain
5	PF20519 Polycystin_dom	5e-65	230.3	Polycystin domain
6	PF02010 REJ	2.2e-103	358.2	REJ domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000253255

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000378326	0.909	Zona pellucida sperm-binding protein 3
2	9606.ENSP00000485105	0.830	Polycystic kidney disease protein 1-like 2
3	9606.ENSP00000338276	0.750	Cysteine-rich secretory protein 1
4	9606.ENSP00000327786	0.747	Izumo sperm-egg fusion protein 1
5	9606.ENSP00000310015	0.729	tRNA-specific adenosine deaminase 1
6	9606.ENSP00000339155	0.721	Cysteine-rich secretory protein 2
7	9606.ENSP00000333363	0.696	Dynein heavy chain 8, axonemal
8	9606.ENSP00000474246	0.694	Izumo sperm-egg fusion protein 3
9	9606.ENSP00000365811	0.617	Sperm-associated antigen 6
10	9606.ENSP00000317671	0.612	Uncharacterized protein C12orf40
11	9606.ENSP00000360379	0.607	Protein FAM209A
12	9606.ENSP00000485487	0.600	Fer-1-like protein 5
13	9606.ENSP00000308279	0.553	Uncharacterized protein C9orf131
14	9606.ENSP00000288462	0.548	Uncharacterized protein C9orf43
15	9606.ENSP00000389026	0.544	Cysteine rich secretory protein family
16	9606.ENSP00000382871	0.527	Melanoma-associated antigen B16
17	9606.ENSP00000327234	0.525	Transmembrane and coiled-coil domains 5A
18	9606.ENSP00000221399	0.504	Tubby like protein 2
19	9606.ENSP00000427802	0.502	Nascent polypeptide-associated complex subunit alpha-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.996	protein binding
GO:0005216	0.968	monoatomic ion channel activity
GO:0005261	0.940	monoatomic cation channel activity
GO:0005262	0.818	calcium channel activity
GO:0043167	0.494	ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0022414	0.987	reproductive process
GO:0009566	0.984	fertilization
GO:0007338	0.964	single fertilization
GO:0050789	0.545	regulation of biological process
GO:0009987	0.404	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0043226	0.758	organelle
GO:0071944	0.714	cell periphery
GO:0005886	0.590	plasma membrane
GO:0043227	0.583	membrane-bounded organelle
GO:0043231	0.373	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29671	0.818	Ca(2+)(in) = Ca(2+)(out)

[back to server]