StarFunc result for job id Q9NTI2

User Input

>input (1188 residues)
MLNGAGLDKALKMSLPRRSRIRSSVGPVRSSLGYKKAEDEMSRATSVGDQLEAPARTIYL
NQPHLNKFRDNQISTAKYSVLTFLPRFLYEQIRRAANAFFLFIALLQQIPDVSPTGRYTT
LVPLIIILTIAGIKEIVEDFKRHKADNAVNKKKTIVLRNGMWHTIMWKEVAVGDIVKVVN
GQYLPADVVLLSSSEPQAMCYVETANLDGETNLKIRQGLSHTADMQTREVLMKLSGTIEC
EGPNRHLYDFTGNLNLDGKSLVALGPDQILLRGTQLRNTQWVFGIVVYTGHDTKLMQNST
KAPLKRSNVEKVTNVQILVLFGILLVMALVSSAGALYWNRSHGEKNWYIKKMDTTSDNFG
YNLLTFIILYNNLIPISLLVTLEVVKYTQALFINWDTDMYYIGNDTPAMARTSNLNEELG
QVKYLFSDKTGTLTCNIMNFKKCSIAGVTYGHFPELAREPSSDDFCRMPPPCSDSCDFDD
PRLLKNIEDRHPTAPCIQEFLTLLAVCHTVVPEKDGDNIIYQASSPDEAALVKGAKKLGF
VFTARTPFSVIIEAMGQEQTFGILNVLEFSSDRKRMSVIVRTPSGRLRLYCKGADNVIFE
RLSKDSKYMEETLCHLEYFATEGLRTLCVAYADLSENEYEEWLKVYQEASTILKDRAQRL
EECYEIIEKNLLLLGATAIEDRLQAGVPETIATLLKAEIKIWVLTGDKQETAINIGYSCR
LVSQNMALILLKEDSLDATRAAITQHCTDLGNLLGKENDVALIIDGHTLKYALSFEVRRS
FLDLALSCKAVICCRVSPLQKSEIVDVVKKRVKAITLAIGDGANDVGMIQTAHVGVGISG
NEGMQATNNSDYAIAQFSYLEKLLLVHGAWSYNRVTKCILYCFYKNVVLYIIELWFAFVN
GFSGQILFERWCIGLYNVIFTALPPFTLGIFERSCTQESMLRFPQLYKITQNGEGFNTKV
FWGHCINALVHSLILFWFPMKALEHDTVLTSGHATDYLFVGNIVYTYVVVTVCLKAGLET
TAWTKFSHLAVWGSMLTWLVFFGIYSTIWPTIPIAPDMRGQATMVLSSAHFWLGLFLVPT
ACLIEDVAWRAAKHTCKKTLLEEVQELETKSRVLGKAVLRDSNGKRLNERDRLIKRLGRK
TPPTLFRGSSLQQGVPHGYAFSQEEHGAVSQEEVIRAYDTTKKKSRKK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O94296	0.879	0.831	0.000	1258	0.453	0.428	O94296.pdb.gz	ATC3_SCHPO Phospholipid-transporting ATPase C887.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC887.12 PE=3 SV=1
2	AFDB:P39524	0.873	0.768	0.000	1355	0.439	0.385	P39524.pdb.gz	ATC3_YEAST Phospholipid-transporting ATPase DRS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DRS2 PE=1 SV=2
3	AFDB:P70704	0.902	0.920	0.000	1164	0.662	0.675	P70704.pdb.gz	AT8A1_MOUSE Phospholipid-transporting ATPase IA OS=Mus musculus OX=10090 GN=Atp8a1 PE=1 SV=2
4	AFDB:Q9NTI2	1.000	1.000	0.000	1188	1.000	1.000	Q9NTI2.pdb.gz	AT8A2_HUMAN Phospholipid-transporting ATPase IB OS=Homo sapiens OX=9606 GN=ATP8A2 PE=1 SV=3
5	AFDB:Q9U280	0.888	0.925	0.000	1139	0.445	0.464	Q9U280.pdb.gz	TAT1_CAEEL Phospholipid-transporting ATPase tat-1 OS=Caenorhabditis elegans OX=6239 GN=tat-1 PE=1 SV=3
6	PDB:6k7lA	0.800	0.954	1.264E-101	992	0.589	0.706	6k7lA.pdb.gz	Cryo-EM structures capture the transport cycle of the P4-ATPase flippase.
7	AFDB:P98198	0.876	0.861	2.886E-100	1209	0.391	0.385	P98198.pdb.gz	AT8B2_HUMAN Phospholipid-transporting ATPase ID OS=Homo sapiens OX=9606 GN=ATP8B2 PE=1 SV=2
8	AFDB:Q8TF62	0.863	0.860	4.590E-100	1192	0.391	0.390	Q8TF62.pdb.gz	AT8B4_HUMAN Probable phospholipid-transporting ATPase IM OS=Homo sapiens OX=9606 GN=ATP8B4 PE=1 SV=3
9	AFDB:Q9XIE6	0.848	0.831	8.644E-100	1213	0.405	0.397	Q9XIE6.pdb.gz	ALA3_ARATH Phospholipid-transporting ATPase 3 OS=Arabidopsis thaliana OX=3702 GN=ALA3 PE=1 SV=2
10	AFDB:Q7YXV5	0.881	0.825	1.804E-98	1270	0.383	0.358	Q7YXV5.pdb.gz	Q7YXV5_CAEEL Phospholipid-transporting ATPase OS=Caenorhabditis elegans OX=6239 GN=tat-2 PE=1 SV=2
11	AFDB:D4AA47	0.860	0.818	6.513E-97	1251	0.398	0.378	D4AA47.pdb.gz	AT8B1_RAT Phospholipid-transporting ATPase IC OS=Rattus norvegicus OX=10116 GN=Atp8b1 PE=1 SV=2
12	PDB:6rohA	0.842	0.897	5.439E-95	1112	0.428	0.458	6rohA.pdb.gz	Structure and autoregulation of a P4-ATPase lipid flippase.
13	PDB:7py4A	0.822	0.876	5.188E-86	1112	0.380	0.406	7py4A.pdb.gz	Autoinhibition and regulation by phosphoinositides of ATP8B1, a human lipid flippase associated with intrahepatic cholestatic disorders.
14	PDB:7vghB	0.828	0.832	1.508E-82	1183	0.384	0.385	7vghB.pdb.gz	Structural insights into the activation of autoinhibited human lipid flippase ATP8B1 upon substrate binding.
15	PDB:7kycA	0.830	0.837	1.818E-81	1178	0.354	0.357	7kycA.pdb.gz	Transport mechanism of P4 ATPase phosphatidylcholine flippases.
16	PDB:7kyaA	0.820	0.829	1.613E-76	1174	0.340	0.344	7kyaA.pdb.gz	Transport mechanism of P4 ATPase phosphatidylcholine flippases.
17	PDB:7bspA	0.667	0.758	1.683E-69	1028	0.323	0.374	7bspA.pdb.gz	Transport Cycle of Plasma Membrane Flippase ATP11C by Cryo-EM.
18	PDB:6lknA	0.762	0.847	4.955E-63	1064	0.322	0.360	6lknA.pdb.gz	Crystal structure of a human plasma membrane phospholipid flippase.
19	PDB:7rd6A	0.722	0.914	9.911E-62	929	0.248	0.318	7rd6A.pdb.gz	Structural basis of the P4B ATPase lipid flippase activity.
20	PDB:7bssA	0.589	0.834	3.626E-50	816	0.245	0.357	7bssA.pdb.gz	Transport Cycle of Plasma Membrane Flippase ATP11C by Cryo-EM.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A5K1VW70	860	1190	0.394	0.393	A0A5K1VW70_HUMAN Phospholipid-transporting ATPase OS=Homo sapiens OX=9606 GN=ATP8B2 PE=1 SV=1
2	A0A8I5ZKC1	1430	985	0.567	0.684	A0A8I5ZKC1_RAT Phospholipid-transporting ATPase OS=Rattus norvegicus OX=10116 GN=Atp8a1 PE=1 SV=1
3	A0A8I5ZXX6	1674	1164	0.669	0.683	A0A8I5ZXX6_RAT Phospholipid-transporting ATPase OS=Rattus norvegicus OX=10116 GN=Atp8a1 PE=1 SV=1
4	A0A8I6AVY6	1665	1164	0.667	0.680	A0A8I6AVY6_RAT Phospholipid-transporting ATPase OS=Rattus norvegicus OX=10116 GN=Atp8a1 PE=1 SV=1
5	A0A8I6G2I8	1433	978	0.567	0.689	A0A8I6G2I8_RAT Phospholipid-transporting ATPase OS=Rattus norvegicus OX=10116 GN=Atp8a1 PE=1 SV=1
6	A3FIN4	819	1183	0.375	0.376	AT8B5_MOUSE Phospholipid-transporting ATPase FetA OS=Mus musculus OX=10090 GN=Atp8b5 PE=2 SV=1
7	C7EXK4	2281	1148	0.925	0.957	AT8A2_BOVIN Phospholipid-transporting ATPase IB OS=Bos taurus OX=9913 GN=ATP8A2 PE=1 SV=4
8	D4A3X6	2177	1169	0.891	0.906	D4A3X6_RAT Phospholipid-transporting ATPase OS=Rattus norvegicus OX=10116 GN=Atp8a2 PE=1 SV=3
9	D4AA47	832	1251	0.392	0.373	AT8B1_RAT Phospholipid-transporting ATPase IC OS=Rattus norvegicus OX=10116 GN=Atp8b1 PE=1 SV=2
10	E9PEJ6	680	1191	0.350	0.349	E9PEJ6_HUMAN Phospholipid-transporting ATPase OS=Homo sapiens OX=9606 GN=ATP11A PE=1 SV=1
11	F1LUT4	1434	984	0.569	0.687	F1LUT4_RAT Phospholipid-transporting ATPase OS=Rattus norvegicus OX=10116 GN=Atp8a1 PE=1 SV=4
12	F4IE35	787	1185	0.391	0.392	F4IE35_ARATH Phospholipid-transporting ATPase OS=Arabidopsis thaliana OX=3702 GN=At1g26130 PE=1 SV=1
13	F4K8T6	602	1139	0.318	0.332	F4K8T6_ARATH Phospholipid-transporting ATPase OS=Arabidopsis thaliana OX=3702 GN=ALA2 PE=1 SV=1
14	H0Y547	623	935	0.310	0.394	H0Y547_HUMAN Phospholipid-transporting ATPase (Fragment) OS=Homo sapiens OX=9606 GN=ATP11A PE=1 SV=1
15	O36028	591	1367	0.285	0.248	ATCZ_SCHPO Phospholipid-transporting ATPase C4F10.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC4F10.16c PE=3 SV=1
16	O43520	838	1251	0.398	0.378	AT8B1_HUMAN Phospholipid-transporting ATPase IC OS=Homo sapiens OX=9606 GN=ATP8B1 PE=1 SV=3
17	O94296	1037	1258	0.449	0.424	ATC3_SCHPO Phospholipid-transporting ATPase C887.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC887.12 PE=3 SV=1
18	P32660	657	1571	0.334	0.253	ATC5_YEAST Phospholipid-transporting ATPase DNF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DNF1 PE=1 SV=2
19	P39524	994	1355	0.442	0.387	ATC3_YEAST Phospholipid-transporting ATPase DRS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=DRS2 PE=1 SV=2
20	P70704	1670	1164	0.668	0.682	AT8A1_MOUSE Phospholipid-transporting ATPase IA OS=Mus musculus OX=10090 GN=Atp8a1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13246 Cation_ATPase	2.4e-11	54.9	Cation transport ATPase (P-type)
2	PF03857 Colicin_im	12	17.3	Colicin immunity protein
3	PF00122 E1-E2_ATPase	3.3e-07	41.5	E1-E2 ATPase
4	PF00702 Hydrolase	0.0034	29.2	haloacid dehalogenase-like hydrolase
5	PF08282 Hydrolase_3	60	14.8	haloacid dehalogenase-like hydrolase
6	PF16212 PhoLip_ATPase_C	2.4e-77	271.7	Phospholipid-translocating P-type ATPase C-terminal
7	PF16209 PhoLip_ATPase_N	9.5e-22	87.8	Phospholipid-translocating ATPase N-terminal

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000371070

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000230461	0.980	Cell cycle control protein 50A
2	9606.ENSP00000371000	0.835	E3 ubiquitin-protein ligase RNF6
3	9606.ENSP00000450842	0.786	Cell cycle control protein 50B
4	9606.ENSP00000419663	0.783	Cell cycle control protein 50C
5	9606.ENSP00000286371	0.686	Sodium/potassium-transporting ATPase subunit beta-3
6	9606.ENSP00000298248	0.660	Lambda-crystallin homolog
7	9606.ENSP00000352603	0.651	AP-4 complex subunit mu-1
8	9606.ENSP00000387365	0.645	Periodic tryptophan protein 1 homolog
9	9606.ENSP00000415556	0.642	DDB1- and CUL4-associated factor 11
10	9606.ENSP00000296161	0.638	E3 ubiquitin-protein ligase DTX3L
11	9606.ENSP00000352208	0.638	Myoferlin
12	9606.ENSP00000479598	0.634	RAD9, HUS1, RAD1-interacting nuclear orphan protein 1
13	9606.ENSP00000462729	0.625	OTU domain-containing protein 7B
14	9606.ENSP00000298832	0.622	Tubulin polyglutamylase TTLL5
15	9606.ENSP00000345752	0.617	Myotubularin-related protein 2
16	9606.ENSP00000386609	0.616	WD repeat-containing protein 81
17	9606.ENSP00000266556	0.615	Tapasin-related protein
18	9606.ENSP00000299886	0.602	Conserved oligomeric Golgi complex subunit 1
19	9606.ENSP00000275162	0.601	Clavesin-2
20	9606.ENSP00000263918	0.582	Striatin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005548	1.000	phospholipid transporter activity
GO:0140327	1.000	flippase activity
GO:0140333	0.987	glycerophospholipid flippase activity
GO:0015247	0.686	aminophospholipid flippase activity
GO:0008525	0.317	phosphatidylcholine transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.992	biological regulation
GO:0009987	0.992	cellular process
GO:0050789	0.940	regulation of biological process
GO:0050794	0.932	regulation of cellular process
GO:0097035	0.922	regulation of membrane lipid distribution
GO:0051179	0.856	localization
GO:0006810	0.854	transport
GO:0033036	0.694	macromolecule localization
GO:0015748	0.685	organophosphate ester transport
GO:0015914	0.681	phospholipid transport
GO:0045332	0.639	phospholipid translocation
GO:0048519	0.406	negative regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	1.000	membrane
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0012505	0.999	endomembrane system
GO:0031982	0.945	vesicle
GO:0031090	0.920	organelle membrane
GO:0031410	0.697	cytoplasmic vesicle
GO:0071944	0.598	cell periphery
GO:0005886	0.594	plasma membrane
GO:0012506	0.450	vesicle membrane
GO:0005794	0.398	Golgi apparatus
GO:0032991	0.366	protein-containing complex
GO:0005768	0.345	endosome
GO:0030659	0.344	cytoplasmic vesicle membrane
GO:0098588	0.338	bounding membrane of organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:7.6.2.1	1.000	P-type phospholipid transporter.

[back to server]