StarFunc result for job id Q9NTI5

User Input

>input (1447 residues)
MAHSKTRTNDGKITYPPGVKEISDKISKEEMVRRLKMVVKTFMDMDQDSEEEKELYLNLA
LHLASDFFLKHPDKDVRLLVACCLADIFRIYAPEAPYTSPDKLKDIFMFITRQLKGLEDT
KSPQFNRYFYLLENIAWVKSYNICFELEDSNEIFTQLYRTLFSVINNGHNQKVHMHMVDL
MSSIICEGDTVSQELLDTVLVNLVPAHKNLNKQAYDLAKALLKRTAQAIEPYITNFFNQV
LMLGKTSISDLSEHVFDLILELYNIDSHLLLSVLPQLEFKLKSNDNEERLQVVKLLAKMF
GAKDSELASQNKPLWQCYLGRFNDIHVPIRLECVKFASHCLMNHPDLAKDLTEYLKVRSH
DPEEAIRHDVIVSIVTAAKKDILLVNDHLLNFVRERTLDKRWRVRKEAMMGLAQIYKKYA
LQSAAGKDAAKQIAWIKDKLLHIYYQNSIDDRLLVERIFAQYMVPHNLETTERMKCLYYL
YATLDLNAVKALNEMWKCQNLLRHQVKDLLDLIKQPKTDASVKAIFSKVMVITRNLPDPG
KAQDFMKKFTQVLEDDEKIRKQLEVLVSPTCSCKQAEGCVREITKKLGNPKQPTNPFLEM
IKFLLERIAPVHIDTESISALIKQVNKSIDGTADDEDEGVPTDQAIRAGLELLKVLSFTH
PISFHSAETFESLLACLKMDDEKVAEAALQIFKNTGSKIEEDFPHIRSALLPVLHHKSKK
GPPRQAKYAIHCIHAIFSSKETQFAQIFEPLHKSLDPSNLEHLITPLVTIGHIALLAPDQ
FAAPLKSLVATFIVKDLLMNDRLPGKKTTKLWVPDEEVSPETMVKIQAIKMMVRWLLGMK
NNHSKSGTSTLRLLTTILHSDGDLTEQGKISKPDMSRLRLAAGSAIVKLAQEPCYHEIIT
LEQYQLCALAINDECYQVRQVFAQKLHKGLSRLRLPLEYMAICALCAKDPVKERRAHARQ
CLVKNINVRREYLKQHAAVSEKLLSLLPEYVVPYTIHLLAHDPDYVKVQDIEQLKDVKEC
LWFVLEILMAKNENNSHAFIRKMVENIKQTKDAQGPDDAKMNEKLYTVCDVAMNIIMSKS
TTYSLESPKDPVLPARFFTQPDKNFSNTKNYLPPEMKSFFTPGKPKTTNVLGAVNKPLSS
AGKQSQTKSSRMETVSNASSSSNPSSPGRIKGRLDSSEMDHSENEDYTMSSPLPGKKSDK
RDDSDLVRSELEKPRGRKKTPVTEQEEKLGMDDLTKLVQEQKPKGSQRSRKRGHTASESD
EQQWPEEKRLKEDILENEDEQNSPPKKGKRGRPPKPLGGGTPKEEPTMKTSKKGSKKKSG
PPAPEEEEEEERQSGNTEQKSKSKQHRVSRRAQQRAESPESSAIESTQSTPQKGRGRPSK
TPSPSQPKKNVRVGRSKQAATKENDSSEEVDVFQGSSPVDDIPQEETEEEEVSTVNVRRR
SAKRERR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q498H0	0.827	0.826	0.000	1448	0.847	0.846	Q498H0.pdb.gz	PD5BA_XENLA Sister chromatid cohesion protein PDS5 homolog B-A OS=Xenopus laevis OX=8355 GN=pds5b-a PE=1 SV=1
2	AFDB:Q6TRW4	0.839	0.839	0.000	1447	0.963	0.963	Q6TRW4.pdb.gz	PDS5B_RAT Sister chromatid cohesion protein PDS5 homolog B OS=Rattus norvegicus OX=10116 GN=Pds5b PE=1 SV=2
3	AFDB:A9IYQ1	0.056	0.260	2.683E-17	302	0.209	1.000	A9IYQ1.pdb.gz	A9IYQ1_HUMAN PDS5 cohesin associated factor B (Fragment) OS=Homo sapiens OX=9606 GN=PDS5B PE=1 SV=1
4	AFDB:Q6PR54	0.165	0.117	9.251E-12	2419	0.130	0.078	Q6PR54.pdb.gz	RIF1_MOUSE Telomere-associated protein RIF1 OS=Mus musculus OX=10090 GN=Rif1 PE=1 SV=2
5	AFDB:Q5UIP0	0.169	0.120	2.579E-10	2472	0.131	0.076	Q5UIP0.pdb.gz	RIF1_HUMAN Telomere-associated protein RIF1 OS=Homo sapiens OX=9606 GN=RIF1 PE=1 SV=2
6	AFDB:E1C2U2	0.173	0.124	6.640E-10	2326	0.149	0.093	E1C2U2.pdb.gz	RIF1_CHICK Telomere-associated protein RIF1 OS=Gallus gallus OX=9031 GN=RIF1 PE=3 SV=3
7	PDB:7qenD	0.206	0.258	1.137E-9	1050	0.100	0.138	7qenD.pdb.gz	A hold-and-feed mechanism drives directional DNA loop extrusion by condensin.
8	PDB:7q2xD	0.246	0.336	1.453E-9	994	0.105	0.153	7q2xD.pdb.gz	Clamping of DNA shuts the condensin neck gate.
9	PDB:6xu2A	0.180	0.225	2.063E-9	1091	0.085	0.113	6xu2A.pdb.gz	X-ray Structure of the Human Karyopherin RanBP5, an Essential Factor for Influenza Polymerase Nuclear Trafficking.
10	PDB:4jlqA	0.136	0.214	2.828E-9	840	0.087	0.150	4jlqA.pdb.gz	Crystal structure of human Karyopherin beta 2 bound to the PY-NLS of Saccharomyces cerevisiae Nab2.
11	AFDB:Q9VW83	0.133	0.116	4.105E-9	1847	0.130	0.102	Q9VW83.pdb.gz	Q9VW83_DROME Gigas, isoform A OS=Drosophila melanogaster OX=7227 GN=gig PE=1 SV=1
12	AFDB:P59764	0.116	0.099	1.174E-8	1978	0.121	0.088	P59764.pdb.gz	DOCK4_MOUSE Dedicator of cytokinesis protein 4 OS=Mus musculus OX=10090 GN=Dock4 PE=1 SV=1
13	PDB:4a0cA	0.160	0.189	1.574E-8	1155	0.092	0.115	4a0cA.pdb.gz	The Molecular Basis of Crl4(Ddb2/Csa) Ubiquitin Ligase Architecture, Targeting, and Activation
14	PDB:6zz6D	0.266	0.332	2.481E-8	1050	0.108	0.149	6zz6D.pdb.gz	Transport of DNA within cohesin involves clamping on top of engaged heads by Scc2 and entrapment within the ring by Scc3.
15	AFDB:F4IAT2	0.126	0.109	3.358E-8	1823	0.144	0.115	F4IAT2.pdb.gz	THOC2_ARATH THO complex subunit 2 OS=Arabidopsis thaliana OX=3702 GN=THO2 PE=1 SV=1
16	PDB:6x9oA	0.131	0.091	7.612E-8	2425	0.113	0.068	6x9oA.pdb.gz
17	PDB:6qnxA	0.127	0.169	7.883E-8	928	0.083	0.129	6qnxA.pdb.gz	The structural basis for cohesin-CTCF-anchored loops.
18	PDB:6ez8A	0.125	0.093	1.333E-7	2353	0.107	0.066	6ez8A.pdb.gz
19	PDB:3w3uA	0.145	0.191	1.381E-7	1030	0.105	0.148	3w3uA.pdb.gz
20	AFDB:Q8IZD9	0.136	0.111	2.226E-7	2030	0.135	0.096	Q8IZD9.pdb.gz	DOCK3_HUMAN Dedicator of cytokinesis protein 3 OS=Homo sapiens OX=9606 GN=DOCK3 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A1Z8S6	0.0	758	1218	0.303	0.360	A1Z8S6_DROME Precocious dissociation of sisters 5, isoform A OS=Drosophila melanogaster OX=7227 GN=pds5 PE=1 SV=1
2	A9IYQ1	0.0	612	302	0.209	1.000	A9IYQ1_HUMAN PDS5 cohesin associated factor B (Fragment) OS=Homo sapiens OX=9606 GN=PDS5B PE=1 SV=1
3	G1UI16	0.0	1907	1337	0.635	0.687	G1UI16_HUMAN SCC-112 protein, isoform CRA_b OS=Homo sapiens OX=9606 GN=PDS5A PE=2 SV=1
4	Q29RF7	0.0	1907	1337	0.635	0.687	PDS5A_HUMAN Sister chromatid cohesion protein PDS5 homolog A OS=Homo sapiens OX=9606 GN=PDS5A PE=1 SV=1
5	Q498H0	0.0	2483	1448	0.852	0.852	PD5BA_XENLA Sister chromatid cohesion protein PDS5 homolog B-A OS=Xenopus laevis OX=8355 GN=pds5b-a PE=1 SV=1
6	Q4QXM3	0.0	1875	1323	0.628	0.686	PD5AA_XENLA Sister chromatid cohesion protein PDS5 homolog A-A OS=Xenopus laevis OX=8355 GN=pds5a-a PE=1 SV=1
7	Q4VA53	0.0	2885	1446	0.963	0.964	PDS5B_MOUSE Sister chromatid cohesion protein PDS5 homolog B OS=Mus musculus OX=10090 GN=Pds5b PE=1 SV=1
8	Q6A026	0.0	1889	1332	0.636	0.691	PDS5A_MOUSE Sister chromatid cohesion protein PDS5 homolog A OS=Mus musculus OX=10090 GN=Pds5a PE=1 SV=3
9	Q6TRW4	0.0	2805	1447	0.958	0.958	PDS5B_RAT Sister chromatid cohesion protein PDS5 homolog B OS=Rattus norvegicus OX=10116 GN=Pds5b PE=1 SV=2
10	Q9NTI5	0.0	2999	1447	1.000	1.000	PDS5B_HUMAN Sister chromatid cohesion protein PDS5 homolog B OS=Homo sapiens OX=9606 GN=PDS5B PE=1 SV=1
11	B6EUB3	4.90e-67	252	1605	0.178	0.161	PDS5A_ARATH Sister chromatid cohesion protein PDS5 homolog A OS=Arabidopsis thaliana OX=3702 GN=PDS5A PE=1 SV=1
12	Q9HFF5	2.38e-64	242	1205	0.198	0.238	PDS5_SCHPO Sister chromatid cohesion protein pds5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pds5 PE=1 SV=1
13	G5EC05	2.21e-55	215	1570	0.209	0.192	G5EC05_CAEEL Cnd1 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=evl-14 PE=1 SV=1
14	Q95U25	1.49e-50	187	415	0.081	0.282	Q95U25_DROME GH12788p OS=Drosophila melanogaster OX=7227 GN=pds5 PE=2 SV=1
15	F4I735	2.75e-47	188	1410	0.176	0.180	PDS5B_ARATH Sister chromatid cohesion protein PDS5 homolog B OS=Arabidopsis thaliana OX=3702 GN=PDS5B PE=3 SV=1
16	Q5AWN4	1.77e-38	160	1506	0.173	0.167	Q5AWN4_EMENI BimD protein OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_07296 PE=4 SV=1
17	Q04264	9.86e-30	131	1277	0.154	0.175	PDS5_YEAST Sister chromatid cohesion protein PDS5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PDS5 PE=1 SV=1
18	A8MRD9	1.60e-25	117	826	0.044	0.076	PDS5D_ARATH Sister chromatid cohesion protein PDS5 homolog D OS=Arabidopsis thaliana OX=3702 GN=PDS5D PE=2 SV=3
19	Q9S9P0	3.27e-18	93.6	990	0.037	0.055	PDS5E_ARATH Sister chromatid cohesion protein PDS5 homolog E OS=Arabidopsis thaliana OX=3702 GN=PDS5E PE=2 SV=1
20	Q8GUP3	2.33e-16	87.4	873	0.033	0.055	PDS5C_ARATH Sister chromatid cohesion protein PDS5 homolog C OS=Arabidopsis thaliana OX=3702 GN=PDS5C PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12717 Cnd1	90	14.5	non-SMC mitotic condensation complex subunit 1
2	PF14390 DUF4420	10	16.9	Putative PD-(D/E)XK family member, (DUF4420)
3	PF02985 HEAT	24	16.5	HEAT repeat
4	PF13646 HEAT_2	2.5	19.9	HEAT repeats
5	PF20168 PDS5	1.9e-297	1001.2	Sister chromatid cohesion protein PDS5 protein
6	PF18714 PI-TkoII_IV	7.4	17.7	DNA polymerase II intein Domain IV

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000001334

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000002828	0.992	WAPL cohesin release factor
2	61853.ENSNLEP00000018841	0.992	Structural maintenance of chromosomes 3
3	61853.ENSNLEP00000004932	0.970	Stromal antigen 1
4	61853.ENSNLEP00000019584	0.970	Nipped-B homolog (Drosophila)
5	61853.ENSNLEP00000019395	0.964	Structural maintenance of chromosomes 1A
6	61853.ENSNLEP00000005872	0.961	RAD21 cohesin complex component
7	61853.ENSNLEP00000020060	0.946	Establishment of sister chromatid cohesion N-acetyltransferase 2
8	61853.ENSNLEP00000018374	0.944	Stromal antigen 2
9	61853.ENSNLEP00000006620	0.943	Cell division cycle associated 5
10	61853.ENSNLEP00000016150	0.937	Structural maintenance of chromosomes 1B
11	61853.ENSNLEP00000008308	0.908	Establishment of sister chromatid cohesion N-acetyltransferase 1
12	61853.ENSNLEP00000005527	0.898	Structural maintenance of chromosomes 4
13	61853.ENSNLEP00000011435	0.893	RAD21-like 1 (S. pombe)
14	61853.ENSNLEP00000014184	0.885	Stromal antigen 3
15	61853.ENSNLEP00000001277	0.875	BRCA2, DNA repair associated
16	61853.ENSNLEP00000018598	0.834	REC8 meiotic recombination protein
17	61853.ENSNLEP00000020806	0.821	PDS5 cohesin associated factor A
18	61853.ENSNLEP00000002108	0.810	Structural maintenance of chromosomes 6
19	61853.ENSNLEP00000022714	0.793	Histone H3 associated protein kinase
20	61853.ENSNLEP00000014587	0.785	Serine/threonine-protein kinase PLK

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0097159	0.746	organic cyclic compound binding
GO:1901363	0.745	heterocyclic compound binding
GO:0003676	0.693	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.988	cellular process
GO:0050789	0.987	regulation of biological process
GO:0050794	0.984	regulation of cellular process
GO:0051276	0.975	chromosome organization
GO:0007049	0.966	cell cycle
GO:0022402	0.963	cell cycle process
GO:0048285	0.953	organelle fission
GO:0007059	0.951	chromosome segregation
GO:0098813	0.924	nuclear chromosome segregation
GO:0048519	0.922	negative regulation of biological process
GO:0000819	0.901	sister chromatid segregation
GO:0000280	0.882	nuclear division
GO:1903047	0.881	mitotic cell cycle process
GO:0048523	0.873	negative regulation of cellular process
GO:0007062	0.864	sister chromatid cohesion
GO:0140014	0.860	mitotic nuclear division
GO:0000070	0.777	mitotic sister chromatid segregation
GO:0032502	0.739	developmental process
GO:0032501	0.732	multicellular organismal process
GO:0048856	0.732	anatomical structure development
GO:0007275	0.710	multicellular organism development
GO:0042127	0.686	regulation of cell population proliferation
GO:0019222	0.683	regulation of metabolic process
GO:0048731	0.646	system development
GO:0048513	0.626	animal organ development
GO:0007423	0.621	sensory organ development
GO:0043010	0.608	camera-type eye development
GO:0002088	0.553	lens development in camera-type eye
GO:0060255	0.498	regulation of macromolecule metabolic process
GO:0031323	0.416	regulation of cellular metabolic process
GO:0080090	0.400	regulation of primary metabolic process
GO:0008285	0.395	negative regulation of cell population proliferation
GO:0051171	0.394	regulation of nitrogen compound metabolic process
GO:0007064	0.381	mitotic sister chromatid cohesion
GO:0019219	0.376	regulation of nucleobase-containing compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0043232	0.993	intracellular non-membrane-bounded organelle
GO:0005829	0.992	cytosol
GO:0016020	0.990	membrane
GO:0005694	0.975	chromosome
GO:0098687	0.902	chromosomal region
GO:0032991	0.777	protein-containing complex
GO:0071944	0.760	cell periphery
GO:0005886	0.691	plasma membrane
GO:0000785	0.536	chromatin
GO:0000775	0.497	chromosome, centromeric region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]