StarFunc result for job id Q9NTJ3

User Input

>input (1288 residues)
MPRKGTQPSTARRREEGPPPPSPDGASSDAEPEPPSGRTESPATAAETASEELDNRSLEE
ILNSIPPPPPPAMTNEAGAPRLMITHIVNQNFKSYAGEKILGPFHKRFSCIIGPNGSGKS
NVIDSMLFVFGYRAQKIRSKKLSVLIHNSDEHKDIQSCTVEVHFQKIIDKEGDDYEVIPN
SNFYVSRTACRDNTSVYHISGKKKTFKDVGNLLRSHGIDLDHNRFLILQGEVEQIAMMKP
KGQTEHDEGMLEYLEDIIGCGRLNEPIKVLCRRVEILNEHRGEKLNRVKMVEKEKDALEG
EKNIAIEFLTLENEIFRKKNHVCQYYIYELQKRIAEMETQKEKIHEDTKEINEKSNILSN
EMKAKNKDVKDTEKKLNKITKFIEENKEKFTQLDLEDVQVREKLKHATSKAKKLEKQLQK
DKEKVEEFKSIPAKSNNIINETTTRNNALEKEKEKEEKKLKEVMDSLKQETQGLQKEKES
REKELMGFSKSVNEARSKMDVAQSELDIYLSRHNTAVSQLTKAKEALIAASETLKERKAA
IRDIEGKLPQTEQELKEKEKELQKLTQEETNFKSLVHDLFQKVEEAKSSLAMNRSRGKVL
DAIIQEKKSGRIPGIYGRLGDLGAIDEKYDVAISSCCHALDYIVVDSIDIAQECVNFLKR
QNIGVATFIGLDKMAVWAKKMTEIQTPENTPRLFDLVKVKDEKIRQAFYFALRDTLVADN
LDQATRVAYQKDRRWRVVTLQGQIIEQSGTMTGGGSKVMKGRMGSSLVIEISEEEVNKME
SQLQNDSKKAMQIQEQKVQLEERVVKLRHSEREMRNTLEKFTASIQRLIEQEEYLNVQVK
ELEANVLATAPDKKKQKLLEENVSAFKTEYDAVAEKAGKVEAEVKRLHNTIVEINNHKLK
AQQDKLDKINKQLDECASAITKAQVAIKTADRNLQKAQDSVLRTEKEIKDTEKEVDDLTA
ELKSLEDKAAEVVKNTNAAEESLPEIQKEHRNLLQELKVIQENEHALQKDALSIKLKLEQ
IDGHIAEHNSKIKYWHKEISKISLHPIEDNPIEEISVLSPEDLEAIKNPDSITNQIALLE
ARCHEMKPNLGAIAEYKKKEELYLQRVAELDKITYERDSFRQAYEDLRKQRLNEFMAGFY
IITNKLKENYQMLTLGGDAELELVDSLDPFSEGIMFSVRPPKKSWKKIFNLSGGEKTLSS
LALVFALHHYKPTPLYFMDEIDAALDFKNVSIVAFYIYEQTKNAQFIIISLRNNMFEISD
RLIGIYKTYNITKSVAVNPKEIASKGLC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P41004	0.372	0.363	0.000	1324	0.352	0.342	P41004.pdb.gz	SMC4_SCHPO Structural maintenance of chromosomes protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cut3 PE=1 SV=2
2	AFDB:P50532	0.530	0.530	0.000	1290	0.766	0.765	P50532.pdb.gz	SMC4_XENLA Structural maintenance of chromosomes protein 4 OS=Xenopus laevis OX=8355 GN=smc4 PE=1 SV=1
3	AFDB:Q12267	0.390	0.356	0.000	1418	0.368	0.334	Q12267.pdb.gz	SMC4_YEAST Structural maintenance of chromosomes protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SMC4 PE=1 SV=1
4	AFDB:Q8CG47	0.813	0.814	0.000	1286	0.895	0.897	Q8CG47.pdb.gz	SMC4_MOUSE Structural maintenance of chromosomes protein 4 OS=Mus musculus OX=10090 GN=Smc4 PE=1 SV=1
5	AFDB:Q9FJL0	0.419	0.433	0.000	1241	0.393	0.408	Q9FJL0.pdb.gz	SMC4_ARATH Structural maintenance of chromosomes protein 4 OS=Arabidopsis thaliana OX=3702 GN=SMC4 PE=1 SV=1
6	AFDB:Q9NTJ3	1.000	1.000	0.000	1288	1.000	1.000	Q9NTJ3.pdb.gz	SMC4_HUMAN Structural maintenance of chromosomes protein 4 OS=Homo sapiens OX=9606 GN=SMC4 PE=1 SV=2
7	AFDB:Q9V3A7	0.375	0.344	0.000	1409	0.382	0.349	Q9V3A7.pdb.gz	Q9V3A7_DROME Structural maintenance of chromosomes protein OS=Drosophila melanogaster OX=7227 GN=glu PE=1 SV=1
8	AFDB:Q20060	0.391	0.329	1.104E-94	1549	0.314	0.261	Q20060.pdb.gz	SMC4_CAEEL Structural maintenance of chromosomes protein 4 OS=Caenorhabditis elegans OX=6239 GN=smc-4 PE=1 SV=1
9	AFDB:Q38CG6	0.435	0.414	1.302E-94	1366	0.291	0.275	Q38CG6.pdb.gz	Q38CG6_TRYB2 Structural maintenance of chromosomes protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.7470 PE=3 SV=1
10	AFDB:P48996	0.473	0.421	1.219E-87	1469	0.273	0.239	P48996.pdb.gz	DPY27_CAEEL Chromosome condensation protein dpy-27 OS=Caenorhabditis elegans OX=6239 GN=dpy-27 PE=1 SV=1
11	PDB:6yvuB	0.349	0.375	2.577E-82	1191	0.339	0.366	6yvuB.pdb.gz
12	PDB:6yvuA	0.219	0.244	2.820E-34	1127	0.167	0.191	6yvuA.pdb.gz
13	PDB:6yvvB	0.311	0.795	9.369E-31	480	0.203	0.544	6yvvB.pdb.gz
14	PDB:7qenB	0.298	0.888	1.618E-29	419	0.179	0.549	7qenB.pdb.gz	A hold-and-feed mechanism drives directional DNA loop extrusion by condensin.
15	PDB:7qcdA	0.196	0.240	7.102E-29	1028	0.140	0.175	7qcdA.pdb.gz	Cryo-EM structure of the Smc5/6 holo-complex.
16	PDB:6wg3A	0.236	0.517	8.370E-29	561	0.133	0.305	6wg3A.pdb.gz	Cryo-EM structure of the human cohesin-NIPBL-DNA complex.
17	PDB:7q2xB	0.255	0.829	7.080E-27	388	0.172	0.570	7q2xB.pdb.gz	Clamping of DNA shuts the condensin neck gate.
18	PDB:7qcdB	0.249	0.308	1.443E-26	998	0.128	0.165	7qcdB.pdb.gz	Cryo-EM structure of the Smc5/6 holo-complex.
19	PDB:6wg3B	0.222	0.400	2.234E-25	693	0.141	0.261	6wg3B.pdb.gz	Cryo-EM structure of the human cohesin-NIPBL-DNA complex.
20	PDB:7ogtA	0.205	0.355	8.255E-20	688	0.085	0.158	7ogtA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9PD53	0.0	2570	1263	0.981	1.000	E9PD53_HUMAN Structural maintenance of chromosomes protein OS=Homo sapiens OX=9606 GN=SMC4 PE=1 SV=1
2	P41004	0.0	752	1324	0.370	0.360	SMC4_SCHPO Structural maintenance of chromosomes protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cut3 PE=1 SV=2
3	P50532	0.0	1971	1290	0.769	0.768	SMC4_XENLA Structural maintenance of chromosomes protein 4 OS=Xenopus laevis OX=8355 GN=smc4 PE=1 SV=1
4	Q12267	0.0	735	1418	0.364	0.331	SMC4_YEAST Structural maintenance of chromosomes protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SMC4 PE=1 SV=1
5	Q8CG47	0.0	2327	1286	0.895	0.897	SMC4_MOUSE Structural maintenance of chromosomes protein 4 OS=Mus musculus OX=10090 GN=Smc4 PE=1 SV=1
6	Q9FJL0	0.0	841	1241	0.410	0.425	SMC4_ARATH Structural maintenance of chromosomes protein 4 OS=Arabidopsis thaliana OX=3702 GN=SMC4 PE=1 SV=1
7	Q9NTJ3	0.0	2637	1288	1.000	1.000	SMC4_HUMAN Structural maintenance of chromosomes protein 4 OS=Homo sapiens OX=9606 GN=SMC4 PE=1 SV=2
8	Q9U6I2	0.0	865	1409	0.384	0.351	Q9U6I2_DROME Structural maintenance of chromosomes protein OS=Drosophila melanogaster OX=7227 GN=glu PE=2 SV=1
9	Q9U9P6	0.0	590	1012	0.259	0.329	Q9U9P6_DROME LD20207p (Fragment) OS=Drosophila melanogaster OX=7227 GN=glu PE=2 SV=2
10	Q9V3A7	0.0	862	1409	0.384	0.351	Q9V3A7_DROME Structural maintenance of chromosomes protein OS=Drosophila melanogaster OX=7227 GN=glu PE=1 SV=1
11	P48996	5.85e-151	495	1469	0.319	0.280	DPY27_CAEEL Chromosome condensation protein dpy-27 OS=Caenorhabditis elegans OX=6239 GN=dpy-27 PE=1 SV=1
12	Q20060	1.36e-102	360	1549	0.238	0.198	SMC4_CAEEL Structural maintenance of chromosomes protein 4 OS=Caenorhabditis elegans OX=6239 GN=smc-4 PE=1 SV=1
13	Q961A5	2.57e-91	308	550	0.144	0.338	Q961A5_DROME LD25919p OS=Drosophila melanogaster OX=7227 GN=glu PE=2 SV=1
14	Q38CG6	5.95e-86	309	1366	0.200	0.189	Q38CG6_TRYB2 Structural maintenance of chromosomes protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.7470 PE=3 SV=1
15	Q9Z1M9	1.25e-76	280	1233	0.269	0.281	SMC1A_RAT Structural maintenance of chromosomes protein 1A OS=Rattus norvegicus OX=10116 GN=Smc1a PE=1 SV=1
16	Q9CU62	1.70e-76	280	1233	0.270	0.282	SMC1A_MOUSE Structural maintenance of chromosomes protein 1A OS=Mus musculus OX=10090 GN=Smc1a PE=1 SV=4
17	A0A384MR33	6.90e-76	278	1233	0.269	0.281	A0A384MR33_HUMAN Structural maintenance of chromosomes protein OS=Homo sapiens OX=9606 GN=SMC1L1 PE=2 SV=1
18	Q14683	6.90e-76	278	1233	0.269	0.281	SMC1A_HUMAN Structural maintenance of chromosomes protein 1A OS=Homo sapiens OX=9606 GN=SMC1A PE=1 SV=2
19	Q8AWB7	3.53e-74	272	1234	0.267	0.279	Q8AWB7_CHICK Structural maintenance of chromosomes protein OS=Gallus gallus OX=9031 GN=SMC1 PE=2 SV=2
20	P32908	1.32e-73	271	1225	0.266	0.279	SMC1_YEAST Structural maintenance of chromosomes protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SMC1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13175 AAA_15	3.8e-06	38.3	AAA ATPase domain
2	PF13304 AAA_21	2.8e-05	35.7	AAA domain, putative AbiEii toxin, Type IV TA system
3	PF13476 AAA_23	5.7e-06	38.5	AAA domain
4	PF13555 AAA_29	1.6	19.9	P-loop containing region of AAA domain
5	PF04108 ATG17_like	1.8e+02	13.0	Autophagy protein ATG17-like domain
6	PF06470 SMC_hinge	1.8e-20	84.8	SMC proteins Flexible Hinge Domain
7	PF02463 SMC_N	6e-59	210.7	RecF/RecN/SMC N terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000349961

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000240423	0.999	Condensin complex subunit 2
2	9606.ENSP00000251496	0.999	Condensin complex subunit 3
3	9606.ENSP00000286398	0.999	Structural maintenance of chromosomes protein 2
4	9606.ENSP00000299821	0.999	Condensin-2 complex subunit H2
5	9606.ENSP00000325017	0.999	Condensin complex subunit 1
6	9606.ENSP00000433681	0.999	Condensin-2 complex subunit D3
7	9606.ENSP00000387007	0.998	Condensin-2 complex subunit G2
8	9606.ENSP00000378699	0.996	Cyclin-dependent kinase 1
9	9606.ENSP00000313950	0.994	Aurora kinase B
10	9606.ENSP00000356379	0.989	Abnormal spindle-like microcephaly-associated protein
11	9606.ENSP00000297338	0.983	Double-strand-break repair protein rad21 homolog
12	9606.ENSP00000261597	0.982	Kinetochore protein NDC80 homolog
13	9606.ENSP00000411532	0.982	DNA topoisomerase 2-alpha
14	9606.ENSP00000260731	0.981	Kinesin-like protein KIF11
15	9606.ENSP00000354957	0.977	Structural maintenance of chromosomes protein 5
16	9606.ENSP00000256442	0.976	G2/mitotic-specific cyclin-B1
17	9606.ENSP00000288207	0.976	G2/mitotic-specific cyclin-B2
18	9606.ENSP00000404092	0.975	Structural maintenance of chromosomes protein 6
19	9606.ENSP00000300093	0.971	Serine/threonine-protein kinase PLK1
20	9606.ENSP00000480987	0.969	DNA replication licensing factor MCM3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0035639	0.996	purine ribonucleoside triphosphate binding
GO:0030554	0.995	adenyl nucleotide binding
GO:0032555	0.995	purine ribonucleotide binding
GO:0032559	0.991	adenyl ribonucleotide binding
GO:0003676	0.979	nucleic acid binding
GO:0003677	0.966	DNA binding
GO:0003682	0.965	chromatin binding
GO:0005524	0.889	ATP binding
GO:0003824	0.668	catalytic activity
GO:0003697	0.573	single-stranded DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006996	0.995	organelle organization
GO:0051276	0.994	chromosome organization
GO:0007059	0.990	chromosome segregation
GO:0048285	0.987	organelle fission
GO:0098813	0.983	nuclear chromosome segregation
GO:0050789	0.979	regulation of biological process
GO:0000280	0.978	nuclear division
GO:0030261	0.977	chromosome condensation
GO:0050794	0.974	regulation of cellular process
GO:0000278	0.933	mitotic cell cycle
GO:1903047	0.921	mitotic cell cycle process
GO:0000070	0.909	mitotic sister chromatid segregation
GO:0048518	0.891	positive regulation of biological process
GO:0048522	0.884	positive regulation of cellular process
GO:0007076	0.729	mitotic chromosome condensation
GO:0008152	0.592	metabolic process
GO:0071704	0.582	organic substance metabolic process
GO:0044238	0.578	primary metabolic process
GO:0006807	0.552	nitrogen compound metabolic process
GO:0044237	0.536	cellular metabolic process
GO:0043170	0.511	macromolecule metabolic process
GO:0051128	0.469	regulation of cellular component organization
GO:0033043	0.463	regulation of organelle organization
GO:0050896	0.403	response to stimulus
GO:0033044	0.399	regulation of chromosome organization
GO:0034641	0.356	cellular nitrogen compound metabolic process
GO:0090304	0.349	nucleic acid metabolic process
GO:0010564	0.313	regulation of cell cycle process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005654	1.000	nucleoplasm
GO:0032991	0.999	protein-containing complex
GO:0005694	0.998	chromosome
GO:0005829	0.991	cytosol
GO:0044815	0.928	DNA packaging complex
GO:0016604	0.829	nuclear body
GO:0016607	0.807	nuclear speck
GO:0000796	0.529	condensin complex
GO:0098687	0.514	chromosomal region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]