StarFunc result for job id Q9NTJ4

User Input

>input (1040 residues)
MAAAPALKHWRTTLERVEKFVSPLYFTDCNLRGRLFGASCPVAVLSSFLTPERLPYQEAV
QRDFRPAQVGDSFGPTWWTCWFRVELTIPEAWVGQEVHLCWESDGEGLVWRDGEPVQGLT
KEGEKTSYVLTDRLGERDPRSLTLYVEVACNGLLGAGKGSMIAAPDPEKMFQLSRAELAV
FHRDVHMLLVDLELLLGIAKGLGKDNQRSFQALYTANQMVNVCDPAQPETFPVAQALASR
FFGQHGGESQHTIHATGHCHIDTAWLWPFKETVRKCARSWVTALQLMERNPEFIFACSQA
QQLEWVKSRYPGLYSRIQEFACRGQFVPVGGTWVEMDGNLPSGEAMVRQFLQGQNFFLQE
FGKMCSEFWLPDTFGYSAQLPQIMHGCGIRRFLTQKLSWNLVNSFPHHTFFWEGLDGSRV
LVHFPPGDSYGMQGSVEEVLKTVANNRDKGRANHSAFLFGFGDGGGGPTQTMLDRLKRLS
NTDGLPRVQLSSPRQLFSALESDSEQLCTWVGELFLELHNGTYTTHAQIKKGNRECERIL
HDVELLSSLALARSAQFLYPAAQLQHLWRLLLLNQFHDVVTGSCIQMVAEEAMCHYEDIR
SHGNTLLSAAAAALCAGEPGPEGLLIVNTLPWKRIEVMALPKPGGAHSLALVTVPSMGYA
PVPPPTSLQPLLPQQPVFVVQETDGSVTLDNGIIRVKLDPTGRLTSLVLVASGREAIAEG
AVGNQFVLFDDVPLYWDAWDVMDYHLETRKPVLGQAGTLAVGTEGGLRGSAWFLLQISPN
SRLSQEVVLDVGCPYVRFHTEVHWHEAHKFLKVEFPARVRSSQATYEIQFGHLQRPTHYN
TSWDWARFEVWAHRWMDLSEHGFGLALLNDCKYGASVRGSILSLSLLRAPKAPDATADTG
RHEFTYALMPHKGSFQDAGVIQAAYSLNFPLLALPAPSPAPATSWSAFSVSSPAVVLETV
KQAESSPQRRSLVLRLYEAHGSHVDCWLHLSLPVQEAILCDLLERPDPAGHLTLRDNRLK
LTFSPFQVLSLLLVLQPPPH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A140VJN9	0.998	0.998	0.000	1040	1.000	1.000	A0A140VJN9.pdb.gz	A0A140VJN9_HUMAN alpha-mannosidase OS=Homo sapiens OX=9606 GN=MAN2C1 PE=2 SV=1
2	AFDB:C8VJ45	0.939	0.892	0.000	1095	0.382	0.363	C8VJ45.pdb.gz	C8VJ45_EMENI alpha-mannosidase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_02936 PE=3 SV=1
3	AFDB:P21139	0.995	0.995	0.000	1040	0.874	0.874	P21139.pdb.gz	MA2C1_RAT Alpha-mannosidase 2C1 OS=Rattus norvegicus OX=10116 GN=Man2c1 PE=1 SV=1
4	AFDB:Q4WX47	0.935	0.895	0.000	1088	0.393	0.376	Q4WX47.pdb.gz	Q4WX47_ASPFU alpha-mannosidase OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_3G08200 PE=3 SV=1
5	AFDB:Q9UT61	0.933	0.902	0.000	1077	0.381	0.368	Q9UT61.pdb.gz	MAN1_SCHPO Alpha-mannosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ams1 PE=1 SV=1
6	PDB:7vqoA	0.936	0.827	2.480E-103	1180	0.391	0.345	7vqoA.pdb.gz	Structural mechanism of protein recognition by the FW domain of autophagy receptor Nbr1
7	AFDB:P22855	0.914	0.879	1.791E-98	1083	0.352	0.338	P22855.pdb.gz	MAN1_YEAST Alpha-mannosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=AMS1 PE=1 SV=2
8	PDB:7dd9A	0.935	0.863	6.847E-98	1129	0.385	0.354	7dd9A.pdb.gz	Molecular and structural mechanisms of ZZ domain-mediated cargo selection by Nbr1.
9	PDB:5jm0A	0.773	0.851	3.378E-59	940	0.314	0.348	5jm0A.pdb.gz
10	AFDB:P54746	0.632	0.743	5.890E-43	877	0.162	0.192	P54746.pdb.gz	MNGB_ECOLI Mannosylglycerate hydrolase OS=Escherichia coli (strain K12) OX=83333 GN=mngB PE=1 SV=2
11	AFDB:P34098	0.607	0.624	5.402E-37	1010	0.157	0.161	P34098.pdb.gz	MANA_DICDI Lysosomal alpha-mannosidase OS=Dictyostelium discoideum OX=44689 GN=manA PE=1 SV=2
12	AFDB:O00754	0.596	0.612	6.878E-36	1011	0.146	0.150	O00754.pdb.gz	MA2B1_HUMAN Lysosomal alpha-mannosidase OS=Homo sapiens OX=9606 GN=MAN2B1 PE=1 SV=3
13	AFDB:P94078	0.605	0.616	2.284E-35	1019	0.147	0.150	P94078.pdb.gz	MANA1_ARATH Alpha-mannosidase At3g26720 OS=Arabidopsis thaliana OX=3702 GN=At3g26720 PE=1 SV=1
14	PDB:6rrnA	0.587	0.615	1.009E-34	989	0.132	0.139	6rrnA.pdb.gz	Manno- epi -cyclophellitols Enable Activity-Based Protein Profiling of Human alpha-Mannosidases and Discovery of New Golgi Mannosidase II Inhibitors.
15	PDB:3bubA	0.584	0.597	4.916E-34	1016	0.132	0.135	3bubA.pdb.gz	Probing the substrate specificity of Golgi alpha-mannosidase II by use of synthetic oligosaccharides and a catalytic nucleophile mutant.
16	PDB:3p0bA	0.241	0.446	3.174E-7	511	0.074	0.151	3p0bA.pdb.gz
17	PDB:6drvA	0.168	0.170	8.699E-7	1024	0.105	0.106	6drvA.pdb.gz
18	PDB:6al2A	0.153	0.293	6.853E-6	484	0.034	0.072	6al2A.pdb.gz
19	PDB:4mmhA	0.137	0.212	2.067E-5	637	0.041	0.068	4mmhA.pdb.gz	Crystal Structure of Pedobacter heparinus Heparin Lyase Hep III with the Active Site in a Deep Cleft
20	PDB:1txkA	0.135	0.254	3.341E-5	490	0.039	0.084	1txkA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A140VJN9	0.0	2143	1040	1.000	1.000	A0A140VJN9_HUMAN alpha-mannosidase OS=Homo sapiens OX=9606 GN=MAN2C1 PE=2 SV=1
2	C8VJ45	0.0	700	1095	0.397	0.377	C8VJ45_EMENI alpha-mannosidase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_02936 PE=3 SV=1
3	P21139	0.0	1780	1040	0.874	0.874	MA2C1_RAT Alpha-mannosidase 2C1 OS=Rattus norvegicus OX=10116 GN=Man2c1 PE=1 SV=1
4	P22855	0.0	559	1083	0.359	0.344	MAN1_YEAST Alpha-mannosidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=AMS1 PE=1 SV=2
5	Q4WX47	0.0	716	1088	0.404	0.386	Q4WX47_ASPFU alpha-mannosidase OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_3G08200 PE=3 SV=1
6	Q91W89	0.0	1852	1039	0.899	0.900	MA2C1_MOUSE Alpha-mannosidase 2C1 OS=Mus musculus OX=10090 GN=Man2c1 PE=1 SV=1
7	Q9NTJ4	0.0	2143	1040	1.000	1.000	MA2C1_HUMAN Alpha-mannosidase 2C1 OS=Homo sapiens OX=9606 GN=MAN2C1 PE=1 SV=1
8	Q9UT61	0.0	657	1077	0.378	0.365	MAN1_SCHPO Alpha-mannosidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ams1 PE=1 SV=1
9	H3BQH9	9.92e-122	371	183	0.176	1.000	H3BQH9_HUMAN Mannosidase alpha class 2C member 1 (Fragment) OS=Homo sapiens OX=9606 GN=MAN2C1 PE=1 SV=8
10	H3BUW3	1.23e-108	337	182	0.160	0.912	H3BUW3_HUMAN Mannosidase alpha class 2C member 1 (Fragment) OS=Homo sapiens OX=9606 GN=MAN2C1 PE=1 SV=8
11	P54746	6.11e-21	101	877	0.095	0.113	MNGB_ECOLI Mannosylglycerate hydrolase OS=Escherichia coli (strain K12) OX=83333 GN=mngB PE=1 SV=2
12	P96937	1.64e-11	71.2	1215	0.107	0.091	P96937_MYCTU Alpha-mannosidase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv0648 PE=3 SV=2
13	Q9LFR0	2.14e-08	60.8	1173	0.040	0.036	GMAN2_ARATH Alpha-mannosidase 2 OS=Arabidopsis thaliana OX=3702 GN=GMII PE=1 SV=1
14	Q54YC4	1.22e-06	55.5	1222	0.086	0.073	MAND_DICDI Alpha-mannosidase D OS=Dictyostelium discoideum OX=44689 GN=manD PE=3 SV=1
15	Q8LPJ3	2.79e-06	53.9	1024	0.096	0.098	MANA2_ARATH Probable alpha-mannosidase At5g13980 OS=Arabidopsis thaliana OX=3702 GN=At5g13980 PE=2 SV=1
16	Q2PJ74	6.41e-06	52.8	1145	0.036	0.032	Q2PJ74_CAEEL Alpha-mannosidase OS=Caenorhabditis elegans OX=6239 GN=aman-2 PE=1 SV=1
17	O18497	4.64e-05	50.1	1130	0.074	0.068	MAN2_SPOFR Alpha-mannosidase 2 OS=Spodoptera frugiperda OX=7108 PE=1 SV=1
18	P27046	6.65e-05	49.7	1150	0.041	0.037	MA2A1_MOUSE Alpha-mannosidase 2 OS=Mus musculus OX=10090 GN=Man2a1 PE=1 SV=2
19	Q24451	7.96e-05	49.3	1108	0.038	0.036	MAN2_DROME Alpha-mannosidase 2 OS=Drosophila melanogaster OX=7227 GN=alpha-Man-IIa PE=1 SV=2
20	Q16706	1.38e-04	48.5	1144	0.043	0.039	MA2A1_HUMAN Alpha-mannosidase 2 OS=Homo sapiens OX=9606 GN=MAN2A1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09261 Alpha-mann_mid	4.5e-24	95.8	Alpha mannosidase middle domain
2	PF17677 Glyco_hydro38C2	6.5e-09	47.1	Glycosyl hydrolases family 38 C-terminal beta sandwich domain
3	PF07748 Glyco_hydro_38C	1.8e-51	186.8	Glycosyl hydrolases family 38 C-terminal domain
4	PF01074 Glyco_hydro_38N	9.2e-80	279.7	Glycosyl hydrolases family 38 N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9593.ENSGGOP00000014467

Rank	PPI partner	STRING score	Description
1	9593.ENSGGOP00000013044	0.936	Alpha-mannosidase
2	9593.ENSGGOP00000007896	0.918	Alpha-mannosidase
3	9593.ENSGGOP00000007719	0.726	Alpha-N-acetylgalactosaminidase
4	9593.ENSGGOP00000003364	0.696	Aspartyl aminopeptidase
5	9593.ENSGGOP00000001072	0.685	Hexosyltransferase
6	9593.ENSGGOP00000018881	0.652	N-glycanase 1
7	9593.ENSGGOP00000020978	0.648	GDP-mannose 4,6-dehydratase
8	9593.ENSGGOP00000010159	0.644	ALG13, UDP-N-acetylglucosaminyltransferase subunit
9	9593.ENSGGOP00000009872	0.642	Mannosyltransferase
10	9593.ENSGGOP00000016255	0.636	Sphingosine-1-phosphate lyase 1
11	9593.ENSGGOP00000008009	0.614	Alpha-mannosidase
12	9593.ENSGGOP00000019679	0.609	Enolase superfamily member 1
13	9593.ENSGGOP00000003858	0.608	Uncharacterized protein
14	9593.ENSGGOP00000001527	0.607	Alpha-mannosidase
15	9593.ENSGGOP00000028380	0.602	Amylo-alpha-1, 6-glucosidase, 4-alpha-glucanotransferase
16	9593.ENSGGOP00000021670	0.589	Succinyl-CoA:3-ketoacid-coenzyme A transferase
17	9593.ENSGGOP00000006239	0.586	3-hydroxybutyrate dehydrogenase 2
18	9593.ENSGGOP00000022595	0.586	Uncharacterized protein
19	9593.ENSGGOP00000001592	0.581	alpha-1,2-Mannosidase
20	9593.ENSGGOP00000014157	0.570	X-ray radiation resistance associated 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004559	1.000	alpha-mannosidase activity
GO:0005488	0.955	binding
GO:0005515	0.954	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.998	organic substance metabolic process
GO:0044238	0.998	primary metabolic process
GO:1901575	0.936	organic substance catabolic process
GO:0009311	0.926	oligosaccharide metabolic process
GO:0016052	0.908	carbohydrate catabolic process
GO:0009313	0.902	oligosaccharide catabolic process
GO:0009987	0.736	cellular process
GO:0044237	0.543	cellular metabolic process
GO:0006807	0.398	nitrogen compound metabolic process
GO:0043170	0.349	macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0070013	0.997	intracellular organelle lumen
GO:0005737	0.996	cytoplasm
GO:0005634	0.988	nucleus
GO:0005829	0.987	cytosol
GO:0005654	0.936	nucleoplasm
GO:0012505	0.577	endomembrane system
GO:0016020	0.301	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.2.1.24	1.000	alpha-mannosidase.

[back to server]