StarFunc result for job id Q9NTK5

User Input

>input (396 residues)
MPPKKGGDGIKPPPIIGRFGTSLKIGIVGLPNVGKSTFFNVLTNSQASAENFPFCTIDPN
ESRVPVPDERFDFLCQYHKPASKIPAFLNVVDIAGLVKGAHNGQGLGNAFLSHISACDGI
FHLTRAFEDDDITHVEGSVDPIRDIEIIHEELQLKDEEMIGPIIDKLEKVAVRGGDKKLK
PEYDIMCKVKSWVIDQKKPVRFYHDWNDKEIEVLNKHLFLTSKPMVYLVNLSEKDYIRKK
NKWLIKIKEWVDKYDPGALVIPFSGALELKLQELSAEERQKYLEANMTQSALPKIIKAGF
AALQLEYFFTAGPDEVRAWTIRKGTKAPQAAGKIHTDFEKGFIMAEVMKYEDFKEEGSEN
AVKAAGKYRQQGRNYIVEDGDIIFFKFNTPQQPKKK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:J3KQ32	0.982	0.935	1.031E-77	416	1.000	0.952	J3KQ32.pdb.gz	J3KQ32_HUMAN Obg-like ATPase 1 OS=Homo sapiens OX=9606 GN=OLA1 PE=1 SV=1
2	AFDB:P91917	0.956	0.958	1.965E-62	395	0.677	0.678	P91917.pdb.gz	OLA1_CAEEL Obg-like ATPase 1 OS=Caenorhabditis elegans OX=6239 GN=ola-1 PE=1 SV=1
3	AFDB:Q9SA73	0.936	0.941	5.820E-58	394	0.619	0.622	Q9SA73.pdb.gz	OLA1_ARATH Obg-like ATPase 1 OS=Arabidopsis thaliana OX=3702 GN=YchF1 PE=1 SV=1
4	AFDB:Q6Z1J6	0.924	0.928	1.151E-54	394	0.616	0.619	Q6Z1J6.pdb.gz	OLA1_ORYSJ Obg-like ATPase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=YCHF1 PE=1 SV=1
5	PDB:2ohfA	0.805	0.972	7.887E-54	327	0.823	0.997	2ohfA.pdb.gz	Human OLA1 defines an ATPase subfamily in the Obg family of GTP-binding proteins
6	AFDB:P38219	0.923	0.927	5.546E-52	394	0.533	0.536	P38219.pdb.gz	OLA1_YEAST Obg-like ATPase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OLA1 PE=1 SV=1
7	AFDB:O13998	0.903	0.912	2.414E-51	392	0.510	0.515	O13998.pdb.gz	OLA1_SCHPO Obg-like ATPase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC27E2.03c PE=1 SV=1
8	PDB:5ee3B	0.868	0.941	1.831E-48	364	0.586	0.637	5ee3B.pdb.gz	ATP binding by the P-loop NTPase OsYchF1 (an unconventional G protein) contributes to biotic but not abiotic stress responses
9	AFDB:P0ABU2	0.866	0.942	2.282E-44	363	0.417	0.455	P0ABU2.pdb.gz	YCHF_ECOLI Ribosome-binding ATPase YchF OS=Escherichia coli (strain K12) OX=83333 GN=ychF PE=1 SV=2
10	PDB:1ni3A	0.862	0.900	4.009E-43	378	0.490	0.513	1ni3A.pdb.gz
11	AFDB:O53459	0.828	0.914	1.997E-42	357	0.402	0.445	O53459.pdb.gz	O53459_MYCTU Ribosome-binding ATPase YchF OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=ychF PE=1 SV=2
12	AFDB:F4I3J0	0.866	0.816	3.814E-42	421	0.417	0.392	F4I3J0.pdb.gz	F4I3J0_ARATH Obg-like ATPase 1 OS=Arabidopsis thaliana OX=3702 GN=ENGD-2 PE=1 SV=1
13	AFDB:P38746	0.860	0.842	1.166E-41	405	0.399	0.390	P38746.pdb.gz	YLF2_YEAST Obg-like ATPase homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YLF2 PE=1 SV=1
14	PDB:7o9kG	0.272	0.314	8.166E-7	337	0.104	0.122	7o9kG.pdb.gz	Structural basis for late maturation steps of the human mitoribosomal large subunit.
15	PDB:4a9aA	0.416	0.454	2.497E-6	356	0.152	0.169	4a9aA.pdb.gz
16	PDB:2zetA	0.267	0.539	2.185E-4	181	0.091	0.199	2zetA.pdb.gz	Structural basis for the exclusive specificity of Slac2-a/melanophilin for the Rab27 GTPases.
17	PDB:1puiA	0.221	0.458	1.135E-3	169	0.086	0.201	1puiA.pdb.gz
18	PDB:6zizA	0.288	0.618	1.615E-3	170	0.081	0.188	6zizA.pdb.gz	Drugging all RAS isoforms with one pocket.
19	PDB:5sziA	0.244	0.490	2.167E-3	174	0.068	0.155	5sziA.pdb.gz	bMERB domains are bivalent Rab8 family effectors evolved by gene duplication.
20	PDB:6elzb	0.268	0.253	2.167E-3	421	0.083	0.078	6elzb.pdb.gz	Visualizing the Assembly Pathway of Nucleolar Pre-60S Ribosomes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	J3KQ32	0.0	814	416	1.000	0.952	J3KQ32_HUMAN Obg-like ATPase 1 OS=Homo sapiens OX=9606 GN=OLA1 PE=1 SV=1
2	P91917	0.0	535	395	0.677	0.678	OLA1_CAEEL Obg-like ATPase 1 OS=Caenorhabditis elegans OX=6239 GN=ola-1 PE=1 SV=1
3	Q9NTK5	0.0	814	396	1.000	1.000	OLA1_HUMAN Obg-like ATPase 1 OS=Homo sapiens OX=9606 GN=OLA1 PE=1 SV=2
4	Q9SA73	4.86e-172	488	394	0.621	0.624	OLA1_ARATH Obg-like ATPase 1 OS=Arabidopsis thaliana OX=3702 GN=YchF1 PE=1 SV=1
5	Q6Z1J6	1.70e-170	483	394	0.619	0.622	OLA1_ORYSJ Obg-like ATPase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=YCHF1 PE=1 SV=1
6	Q6FXN6	2.96e-140	407	393	0.535	0.539	Q6FXN6_CANGA Obg-like ATPase 1 OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=OLA1 PE=3 SV=1
7	P38219	3.77e-140	406	394	0.533	0.536	OLA1_YEAST Obg-like ATPase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OLA1 PE=1 SV=1
8	O13998	1.30e-139	405	392	0.510	0.515	OLA1_SCHPO Obg-like ATPase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC27E2.03c PE=1 SV=1
9	F4I3J0	6.07e-103	313	421	0.424	0.399	F4I3J0_ARATH Obg-like ATPase 1 OS=Arabidopsis thaliana OX=3702 GN=ENGD-2 PE=1 SV=1
10	P0ABU2	3.99e-102	308	363	0.417	0.455	YCHF_ECOLI Ribosome-binding ATPase YchF OS=Escherichia coli (strain K12) OX=83333 GN=ychF PE=1 SV=2
11	P38746	8.54e-92	283	405	0.394	0.385	YLF2_YEAST Obg-like ATPase homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YLF2 PE=1 SV=1
12	O53459	1.25e-81	256	357	0.407	0.451	O53459_MYCTU Ribosome-binding ATPase YchF OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=ychF PE=1 SV=2
13	C9JTK6	1.67e-79	241	116	0.293	1.000	C9JTK6_HUMAN Obg like ATPase 1 (Fragment) OS=Homo sapiens OX=9606 GN=OLA1 PE=1 SV=1
14	Q586V0	5.06e-58	195	367	0.316	0.341	Q586V0_TRYB2 GTP binding protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=28H13.470 PE=4 SV=1
15	P42942	7.75e-18	86.7	411	0.141	0.136	YG4I_YEAST Uncharacterized GTP-binding protein YGR210C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YGR210C PE=1 SV=1
16	O94362	3.87e-15	78.6	409	0.136	0.132	YHOF_SCHPO Uncharacterized GTP-binding protein C428.15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC428.15 PE=3 SV=1
17	Q5F5D9	1.39e-13	73.9	384	0.109	0.112	OBG_NEIG1 GTPase Obg OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) OX=242231 GN=obg PE=1 SV=1
18	Q8L7L0	1.96e-13	74.3	681	0.114	0.066	OBGC_ARATH GTP-binding protein OBGC, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=OBGL PE=2 SV=1
19	P42641	4.91e-13	72.4	390	0.106	0.108	OBG_ECOLI GTPase ObgE/CgtA OS=Escherichia coli (strain K12) OX=83333 GN=obgE PE=1 SV=1
20	Q5L6R9	4.78e-12	68.9	335	0.116	0.137	OBG_CHLAB GTPase Obg OS=Chlamydia abortus (strain DSM 27085 / S26/3) OX=218497 GN=obg PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00350 Dynamin_N	1.7e+02	13.7	Dynamin family
2	PF02421 FeoB_N	0.00062	30.8	Ferrous iron transport protein B
3	PF03308 MeaB	43	14.5	Methylmalonyl Co-A mutase-associated GTPase MeaB
4	PF01926 MMR_HSR1	1.4e-19	81.6	50S ribosome-binding GTPase
5	PF08477 Roc	2.5e+02	13.3	Ras of Complex, Roc, domain of DAPkinase
6	PF02824 TGS	12	17.3	TGS domain
7	PF06071 YchF-GTPase_C	7.2e-38	140.0	Protein of unknown function (DUF933)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 246437.XP_006151186.1

Rank	PPI partner	STRING score	Description
1	246437.XP_006156649.1	0.875	Elongation factor 1-gamma
2	246437.XP_006169972.1	0.852	Heat shock protein family A (Hsp70) member 9
3	246437.XP_006142912.1	0.796	Bardet-Biedl syndrome 10 protein homolog isoform X1
4	246437.XP_006146724.1	0.772	Eukaryotic translation initiation factor 2 subunit 3
5	246437.XP_006167232.1	0.772	Eukaryotic translation initiation factor 2 subunit 3-like
6	246437.XP_006140244.1	0.750	60S ribosomal protein L5
7	246437.XP_006160649.1	0.750	60S ribosomal protein L5-like
8	246437.XP_006147504.1	0.735	Guanine nucleotide-binding protein subunit beta-2-like 1
9	246437.XP_006140298.1	0.717	Bifunctional aminoacyl-tRNA synthetase
10	246437.XP_006166926.1	0.715	Heat shock 70 kDa protein 4
11	246437.XP_006144520.1	0.709	60S ribosomal protein L27a
12	246437.XP_006162964.1	0.700	Belongs to the universal ribosomal protein uL15 family.
13	246437.XP_006154353.1	0.687	Valyl-tRNA synthetase
14	246437.XP_006166785.1	0.682	40S ribosomal protein S5
15	246437.XP_006145889.1	0.675	28S ribosomal protein S7, mitochondrial
16	246437.XP_006165654.1	0.672	Proliferation-associated protein 2G4
17	246437.XP_006169971.1	0.669	Eukaryotic peptide chain release factor subunit 1
18	246437.XP_006148327.1	0.667	T-complex protein 1 subunit zeta
19	246437.XP_006158020.1	0.655	CTP synthase 2
20	246437.XP_006164986.1	0.655	CTP synthase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0035639	1.000	purine ribonucleoside triphosphate binding
GO:0016887	1.000	ATP hydrolysis activity
GO:0032555	1.000	purine ribonucleotide binding
GO:0005524	0.991	ATP binding
GO:0032561	0.932	guanyl ribonucleotide binding
GO:0003924	0.917	GTPase activity
GO:0005525	0.844	GTP binding
GO:0050839	0.712	cell adhesion molecule binding
GO:0045296	0.703	cadherin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.982	organic substance metabolic process
GO:0044238	0.981	primary metabolic process
GO:0044237	0.981	cellular metabolic process
GO:0006807	0.971	nitrogen compound metabolic process
GO:1901564	0.943	organonitrogen compound metabolic process
GO:0034641	0.933	cellular nitrogen compound metabolic process
GO:0019693	0.890	ribose phosphate metabolic process
GO:1901360	0.849	organic cyclic compound metabolic process
GO:0006139	0.842	nucleobase-containing compound metabolic process
GO:0009259	0.832	ribonucleotide metabolic process
GO:0009144	0.827	purine nucleoside triphosphate metabolic process
GO:0009199	0.818	ribonucleoside triphosphate metabolic process
GO:0009205	0.813	purine ribonucleoside triphosphate metabolic process
GO:0009150	0.797	purine ribonucleotide metabolic process
GO:0046034	0.728	ATP metabolic process
GO:0050896	0.515	response to stimulus
GO:0065007	0.300	biological regulation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043229	0.999	intracellular organelle
GO:0005829	0.998	cytosol
GO:0043232	0.988	intracellular non-membrane-bounded organelle
GO:0070013	0.974	intracellular organelle lumen
GO:0043231	0.967	intracellular membrane-bounded organelle
GO:0032991	0.784	protein-containing complex
GO:0005634	0.717	nucleus
GO:0012505	0.680	endomembrane system
GO:0005856	0.538	cytoskeleton
GO:0015630	0.529	microtubule cytoskeleton
GO:0005815	0.379	microtubule organizing center
GO:0005813	0.354	centrosome
GO:0005654	0.316	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:13065	1.000	ATP + H2O = ADP + H(+) + phosphate
RHEA:19669	0.917	GTP + H2O = GDP + H(+) + phosphate

[back to server]