StarFunc result for job id Q9NTX5

User Input

>input (307 residues)
MALKQEMAKSLLKTASLSGRTKLLHQTGLSLYSTSHGFYEEEVKKTLQQFPGGSIDLQKE
DNGIGILTLNNPSRMNAFSGVMMLQLLEKVIELENWTEGKGLIVRGAKNTFSSGSDLNAV
KSLGTPEDGMAVCMFMQNTLTRFMRLPLISVALVQGWALGGGAEFTTACDFRLMTPESKI
RFVHKEMGIIPSWGGTTRLVEIIGSRQALKVLSGALKLDSKNALNIGMVEEVLQSSDETK
SLEEAQEWLKQFIQGPPEVIRALKKSVCSGRELYLEEALQNERDLLGTVWGGPANLEAIA
KKGKFNK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NTX5	1.000	1.000	3.804E-60	307	1.000	1.000	Q9NTX5.pdb.gz	ECHD1_HUMAN Ethylmalonyl-CoA decarboxylase OS=Homo sapiens OX=9606 GN=ECHDC1 PE=1 SV=2
2	AFDB:Q9D9V3	0.941	0.897	9.649E-52	322	0.805	0.767	Q9D9V3.pdb.gz	ECHD1_MOUSE Ethylmalonyl-CoA decarboxylase OS=Mus musculus OX=10090 GN=Echdc1 PE=1 SV=2
3	AFDB:P9WNN9	0.727	0.858	1.914E-20	257	0.208	0.249	P9WNN9.pdb.gz	ECHA8_MYCTU Probable enoyl-CoA hydratase EchA8 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=echA8 PE=1 SV=1
4	AFDB:Q9FHR8	0.741	0.814	5.382E-20	278	0.176	0.194	Q9FHR8.pdb.gz	DCI1_ARATH Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, peroxisomal OS=Arabidopsis thaliana OX=3702 GN=DCI1 PE=1 SV=1
5	AFDB:A4YI89	0.748	0.879	5.700E-20	259	0.208	0.247	A4YI89.pdb.gz	HPCD_METS5 3-hydroxypropionyl-coenzyme A dehydratase OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348 / JCM 9185 / NBRC 15509 / TH2) OX=399549 GN=Msed_2001 PE=1 SV=1
6	AFDB:Q13825	0.753	0.685	8.045E-20	339	0.251	0.227	Q13825.pdb.gz	AUHM_HUMAN Methylglutaconyl-CoA hydratase, mitochondrial OS=Homo sapiens OX=9606 GN=AUH PE=1 SV=1
7	AFDB:F4JML5	0.757	0.772	1.274E-19	301	0.189	0.193	F4JML5.pdb.gz	ECH2M_ARATH Probable enoyl-CoA hydratase 2, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At4g16800 PE=2 SV=1
8	PDB:3h81A	0.717	0.847	1.840E-19	256	0.205	0.246	3h81A.pdb.gz	Increasing the structural coverage of tuberculosis drug targets.
9	AFDB:P9WNN3	0.709	0.850	1.904E-19	254	0.189	0.228	P9WNN3.pdb.gz	ECH17_MYCTU Probable enoyl-CoA hydratase EchA17 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=echA17 PE=1 SV=2
10	PDB:5zaiC	0.734	0.862	3.882E-19	259	0.218	0.259	5zaiC.pdb.gz	Structural Insight into Substrate Specificity of 3-Hydroxypropionyl-Coenzyme A Dehydratase from Metallosphaera sedula
11	AFDB:P30084	0.713	0.751	4.771E-19	290	0.176	0.186	P30084.pdb.gz	ECHM_HUMAN Enoyl-CoA hydratase, mitochondrial OS=Homo sapiens OX=9606 GN=ECHS1 PE=1 SV=4
12	AFDB:Q5LLW6	0.755	0.861	5.053E-19	267	0.173	0.199	Q5LLW6.pdb.gz	DMDD_RUEPO Methylthioacryloyl-CoA hydratase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) OX=246200 GN=dmdD PE=1 SV=1
13	PDB:4izcB	0.752	0.861	9.730E-19	266	0.173	0.199	4izcB.pdb.gz	Crystal Structure of DmdD, a Crotonase Superfamily Enzyme That Catalyzes the Hydration and Hydrolysis of Methylthioacryloyl-CoA.
14	PDB:2hw5C	0.720	0.839	8.144E-18	260	0.179	0.212	2hw5C.pdb.gz	The crystal structure of human enoyl-coenzyme A (CoA) hydratase short chain 1, ECHS1
15	PDB:4fzwB	0.724	0.858	1.446E-17	256	0.186	0.223	4fzwB.pdb.gz
16	PDB:1dubA	0.715	0.833	4.560E-17	260	0.179	0.212	1dubA.pdb.gz	Crystal structure of enoyl-coenzyme A (CoA) hydratase at 2.5 angstroms resolution: a spiral fold defines the CoA-binding pocket.
17	PDB:4fzwD	0.698	0.845	8.576E-17	250	0.218	0.268	4fzwD.pdb.gz
18	PDB:5dtwC	0.562	0.687	1.523E-16	246	0.166	0.207	5dtwC.pdb.gz	THPP target assignment reveals EchA6 as an essential fatty acid shuttle in mycobacteria.
19	PDB:4i42A	0.638	0.683	4.802E-16	285	0.173	0.186	4i42A.pdb.gz	Structural basis of the induced-fit mechanism of 1,4-dihydroxy-2-naphthoyl coenzyme A synthase from the crotonase fold superfamily
20	PDB:1jxzB	0.715	0.809	6.777E-16	269	0.150	0.171	1jxzB.pdb.gz	Histidine 90 Function in 4-chlorobenzoyl-coenzyme A Dehalogenase Catalysis

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9D9V3	0.0	508	322	0.811	0.773	ECHD1_MOUSE Ethylmalonyl-CoA decarboxylase OS=Mus musculus OX=10090 GN=Echdc1 PE=1 SV=2
2	Q9NTX5	0.0	624	307	1.000	1.000	ECHD1_HUMAN Ethylmalonyl-CoA decarboxylase OS=Homo sapiens OX=9606 GN=ECHDC1 PE=1 SV=2
3	P21177	1.15e-25	109	729	0.212	0.089	FADB_ECOLI Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain K12) OX=83333 GN=fadB PE=1 SV=2
4	Q6NL24	1.24e-22	96.7	265	0.218	0.253	ECH1P_ARATH Probable enoyl-CoA hydratase 1, peroxisomal OS=Arabidopsis thaliana OX=3702 GN=ECHIA PE=1 SV=1
5	A4YI89	4.53e-22	95.1	259	0.189	0.224	HPCD_METS5 3-hydroxypropionyl-coenzyme A dehydratase OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348 / JCM 9185 / NBRC 15509 / TH2) OX=399549 GN=Msed_2001 PE=1 SV=1
6	P9WNN9	5.29e-22	94.7	257	0.212	0.253	ECHA8_MYCTU Probable enoyl-CoA hydratase EchA8 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=echA8 PE=1 SV=1
7	P9WNN3	1.53e-20	90.9	261	0.199	0.234	ECH17_MYCTU Probable enoyl-CoA hydratase EchA17 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=echA17 PE=1 SV=2
8	A1Z934	4.85e-19	87.4	299	0.189	0.194	A1Z934_DROME SD19268p OS=Drosophila melanogaster OX=7227 GN=Dmel\CG8778 PE=1 SV=1
9	P77399	2.56e-17	84.7	714	0.166	0.071	FADJ_ECOLI Fatty acid oxidation complex subunit alpha OS=Escherichia coli (strain K12) OX=83333 GN=fadJ PE=1 SV=1
10	P76082	6.78e-17	80.9	255	0.208	0.251	PAAF_ECOLI 2,3-dehydroadipyl-CoA hydratase OS=Escherichia coli (strain K12) OX=83333 GN=paaF PE=1 SV=1
11	Q39659	8.70e-17	82.8	725	0.176	0.074	MFPA_CUCSA Glyoxysomal fatty acid beta-oxidation multifunctional protein MFP-a OS=Cucumis sativus OX=3659 PE=1 SV=1
12	C8V3K8	9.53e-17	80.9	289	0.221	0.235	C8V3K8_EMENI Enoyl-CoA hydratase (Eurofung) OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_05916 PE=3 SV=1
13	G4V4T7	1.08e-16	80.5	265	0.202	0.234	DPGD_AMYOR Enoyl-CoA-hydratase OS=Amycolatopsis orientalis OX=31958 GN=dpgD PE=1 SV=1
14	A7YT47	2.13e-15	79.0	761	0.169	0.068	A7YT47_DANRE enoyl-CoA hydratase OS=Danio rerio OX=7955 GN=hadha PE=1 SV=1
15	O35459	3.53e-15	77.0	327	0.212	0.199	ECH1_MOUSE Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial OS=Mus musculus OX=10090 GN=Ech1 PE=1 SV=1
16	P0ABU0	5.37e-15	75.9	285	0.182	0.196	MENB_ECOLI 1,4-dihydroxy-2-naphthoyl-CoA synthase OS=Escherichia coli (strain K12) OX=83333 GN=menB PE=1 SV=1
17	Q9JLZ3	7.12e-15	75.9	314	0.215	0.210	AUHM_MOUSE Methylglutaconyl-CoA hydratase, mitochondrial OS=Mus musculus OX=10090 GN=Auh PE=1 SV=1
18	Q9I298	8.74e-15	75.1	265	0.176	0.204	Q9I298_PSEAE 3-methylglutaconyl-CoA hydratase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=liuC PE=3 SV=1
19	Q13825	9.38e-15	75.9	339	0.228	0.206	AUHM_HUMAN Methylglutaconyl-CoA hydratase, mitochondrial OS=Homo sapiens OX=9606 GN=AUH PE=1 SV=1
20	Q62651	9.67e-15	75.9	327	0.205	0.193	ECH1_RAT Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial OS=Rattus norvegicus OX=10116 GN=Ech1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00378 ECH_1	5.9e-31	119.3	Enoyl-CoA hydratase/isomerase
2	PF16113 ECH_2	2.2e-14	65.4	Enoyl-CoA hydratase/isomerase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000436585

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000244217	0.962	Methylmalonyl-CoA epimerase, mitochondrial
2	9606.ENSP00000242592	0.955	Short-chain specific acyl-CoA dehydrogenase, mitochondrial
3	9606.ENSP00000450436	0.937	Methylmalonate-semialdehyde dehydrogenase [acylating], mitochondrial
4	9606.ENSP00000285093	0.935	3-ketoacyl-CoA thiolase, mitochondrial
5	9606.ENSP00000293217	0.933	Peroxisomal acyl-coenzyme A oxidase 1
6	9606.ENSP00000348775	0.925	Peroxisomal acyl-coenzyme A oxidase 3
7	9606.ENSP00000325136	0.924	hydroxyacyl-CoA dehydrogenase trifunctional multienzyme complex subunit beta
8	9606.ENSP00000359151	0.923	Dihydrolipoamide branched chain transacylase E2
9	9606.ENSP00000316924	0.917	Acetyl-coenzyme A synthetase 2-like, mitochondrial
10	9606.ENSP00000253382	0.910	Acetyl-coenzyme A synthetase, cytoplasmic
11	9606.ENSP00000449535	0.910	Acyl-CoA synthetase short-chain family member 3, mitochondrial
12	9606.ENSP00000419027	0.886	This is one of the 2 subunits of the biotin-dependent propionyl-CoA carboxylase (PCC), a mitochondrial enzyme involved in the catabolism of odd chain fatty acids, branched-chain amino acids isoleucine, threonine, methionine, and valine and other metabolites . Propionyl-CoA carboxylase catalyzes the carboxylation of propionyl-CoA/propanoyl-CoA to D-methylmalonyl- CoA/(S)-methylmalonyl-CoA . Within the holoenzyme, the alpha subunit catalyzes the ATP-dependent carboxylation of the biotin carried by the biotin carboxyl carrier (BCC) domain, while the beta subunit then transfers the carboxy [...]
13	9606.ENSP00000333664	0.885	3-ketoacyl-CoA thiolase, peroxisomal
14	9606.ENSP00000265395	0.867	3-hydroxyisobutyrate dehydrogenase, mitochondrial
15	9606.ENSP00000379845	0.853	4-aminobutyrate aminotransferase, mitochondrial
16	9606.ENSP00000387123	0.851	Alpha-aminoadipic semialdehyde dehydrogenase
17	9606.ENSP00000231887	0.850	Peroxisomal bifunctional enzyme
18	9606.ENSP00000365462	0.850	This is one of the 2 subunits of the biotin-dependent propionyl-CoA carboxylase (PCC), a mitochondrial enzyme involved in the catabolism of odd chain fatty acids, branched-chain amino acids isoleucine, threonine, methionine, and valine and other metabolites . Propionyl-CoA carboxylase catalyzes the carboxylation of propionyl-CoA/propanoyl-CoA to D-methylmalonyl- CoA/(S)-methylmalonyl-CoA (PubMed:8434582, PubMed:6765947, PubMed:10101253). Within the holoenzyme, the alpha subunit catalyzes the ATP-dependent carboxylation of the biotin carried by the biotin carboxyl carrier (BCC) domain, [...]
19	9606.ENSP00000261733	0.834	Aldehyde dehydrogenase, mitochondrial
20	9606.ENSP00000346827	0.834	4-trimethylaminobutyraldehyde dehydrogenase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003824	1.000	catalytic activity
GO:0005515	0.999	protein binding
GO:0016829	0.937	lyase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.999	organic substance metabolic process
GO:0044237	0.999	cellular metabolic process
GO:0044238	0.998	primary metabolic process
GO:0044281	0.997	small molecule metabolic process
GO:0019752	0.985	carboxylic acid metabolic process
GO:0006629	0.956	lipid metabolic process
GO:0044255	0.943	cellular lipid metabolic process
GO:0046395	0.933	carboxylic acid catabolic process
GO:0032787	0.881	monocarboxylic acid metabolic process
GO:0006631	0.856	fatty acid metabolic process
GO:0072329	0.519	monocarboxylic acid catabolic process
GO:0006807	0.478	nitrogen compound metabolic process
GO:0016042	0.440	lipid catabolic process
GO:1901564	0.365	organonitrogen compound metabolic process
GO:0044242	0.351	cellular lipid catabolic process
GO:0009062	0.330	fatty acid catabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0070013	0.997	intracellular organelle lumen
GO:0043231	0.986	intracellular membrane-bounded organelle
GO:0005739	0.984	mitochondrion
GO:0005829	0.971	cytosol
GO:0016020	0.842	membrane
GO:0005759	0.738	mitochondrial matrix
GO:0005634	0.635	nucleus
GO:0031981	0.500	nuclear lumen
GO:0005654	0.403	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:4.-.-.-	0.937	Lyases.

[back to server]