StarFunc result for job id Q9NTZ6

User Input

>input (932 residues)
MAVVIRLQGLPIVAGTMDIRHFFSGLTIPDGGVHIVGGELGEAFIVFATDEDARLGMMRT
GGTIKGSKVTLLLSSKTEMQNMIELSRRRFETANLDIPPANASRSGPPPSSGMSSRVNLP
TTVSNFNNPSPSVVTATTSVHESNKNIQTFSTASVGTAPPNMGASFGSPTFSSTVPSTAS
PMNTVPPPPIPPIPAMPSLPPMPSIPPIPVPPPVPTLPPVPPVPPIPPVPSVPPMTPLPP
MSGMPPLNPPPVAPLPAGMNGSGAPMNLNNNLNPMFLGPLNPVNPIQMNSQSSVKPLPIN
PDDLYVSVHGMPFSAMENDVRDFFHGLRVDAVHLLKDHVGRNNGNGLVKFLSPQDTFEAL
KRNRMLMIQRYVEVSPATERQWVAAGGHITFKQNMGPSGQTHPPPQTLPRSKSPSGQKRS
RSRSPHEAGFCVYLKGLPFEAENKHVIDFFKKLDIVEDSIYIAYGPNGKATGEGFVEFRN
EADYKAALCRHKQYMGNRFIQVHPITKKGMLEKIDMIRKRLQNFSYDQREMILNPEGDVN
SAKVCAHITNIPFSITKMDVLQFLEGIPVDENAVHVLVDNNGQGLGQALVQFKNEDDARK
SERLHRKKLNGREAFVHVVTLEDMREIEKNPPAQGKKGLKMPVPGNPAVPGMPNAGLPGV
GLPSAGLPGAGLPSTGLPGSAITSAGLPGAGMPSAGIPSAGGEEHAFLTVGSKEANNGPP
FNFPGNFGGSNAFGPPIPPPGLGGGAFGDARPGMPSVGNSGLPGLGLDVPGFGGGPNNLS
GPSGFGGGPQNFGNGPGSLGGPPGFGSGPPGLGSAPGHLGGPPAFGPGPGPGPGPGPIHI
GGPPGFASSSGKPGPTVIKVQNMPFTVSIDEILDFFYGYQVIPGSVCLKYNEKGMPTGEA
MVAFESRDEATAAVIDLNDRPIGSRKVKLVLG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NTZ6	1.000	1.000	0.000	932	1.000	1.000	Q9NTZ6.pdb.gz	RBM12_HUMAN RNA-binding protein 12 OS=Homo sapiens OX=9606 GN=RBM12 PE=1 SV=1
2	AFDB:Q9W0D6	0.120	0.115	1.930E-42	985	0.221	0.209	Q9W0D6.pdb.gz	Q9W0D6_DROME FI22004p1 OS=Drosophila melanogaster OX=7227 GN=cg7879 PE=1 SV=1
3	AFDB:Q6DRJ8	0.103	0.134	5.465E-18	667	0.121	0.169	Q6DRJ8.pdb.gz
4	AFDB:H7BY16	0.141	0.170	2.152E-16	734	0.086	0.109	H7BY16.pdb.gz	H7BY16_HUMAN Nucleolin OS=Homo sapiens OX=9606 GN=NCL PE=1 SV=9
5	AFDB:P19338	0.154	0.196	9.035E-16	710	0.089	0.117	P19338.pdb.gz	NUCL_HUMAN Nucleolin OS=Homo sapiens OX=9606 GN=NCL PE=1 SV=3
6	PDB:5vsuA	0.119	0.226	3.415E-13	387	0.057	0.137	5vsuA.pdb.gz	Architecture of the U6 snRNP reveals specific recognition of 3'-end processed U6 snRNA.
7	AFDB:O13674	0.088	0.119	7.891E-13	654	0.102	0.145	O13674.pdb.gz	MUG24_SCHPO Meiotically up-regulated gene 24 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug24 PE=1 SV=1
8	AFDB:Q9SJG8	0.086	0.093	2.094E-12	843	0.143	0.158	Q9SJG8.pdb.gz	AML2_ARATH Protein MEI2-like 2 OS=Arabidopsis thaliana OX=3702 GN=ML2 PE=2 SV=2
9	AFDB:Q14966	0.120	0.070	2.487E-12	1978	0.127	0.060	Q14966.pdb.gz	ZN638_HUMAN Zinc finger protein 638 OS=Homo sapiens OX=9606 GN=ZNF638 PE=1 SV=2
10	AFDB:Q8VWF5	0.089	0.102	6.987E-12	800	0.142	0.165	Q8VWF5.pdb.gz	AML5_ARATH Protein MEI2-like 5 OS=Arabidopsis thaliana OX=3702 GN=ML5 PE=1 SV=1
11	AFDB:A0A0B4K6W9	0.086	0.089	1.098E-10	898	0.128	0.133	A0A0B4K6W9.pdb.gz	A0A0B4K6W9_DROME Hephaestus, isoform Y OS=Drosophila melanogaster OX=7227 GN=heph PE=1 SV=1
12	PDB:6r5kH	0.136	0.258	3.752E-10	394	0.060	0.142	6r5kH.pdb.gz	Molecular Basis for poly(A) RNP Architecture and Recognition by the Pan2-Pan3 Deadenylase.
13	PDB:7oqcF	0.084	0.269	2.223E-9	267	0.040	0.139	7oqcF.pdb.gz	Structural insights into how Prp5 proofreads the pre-mRNA branch site.
14	PDB:6y53o	0.094	0.453	2.623E-8	160	0.046	0.269	6y53o.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
15	PDB:7evoD	0.081	0.350	2.759E-7	200	0.035	0.165	7evoD.pdb.gz	Structural Insights into Branch Site Proofreading by Human Spliceosome.
16	PDB:5lsbA	0.084	0.377	1.158E-6	176	0.034	0.182	5lsbA.pdb.gz
17	PDB:6y5qq	0.075	0.351	9.145E-6	178	0.032	0.169	6y5qq.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
18	PDB:6qx91K	0.081	0.359	1.367E-5	201	0.028	0.129	6qx91K.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
19	PDB:7dvqY	0.087	0.516	1.367E-5	140	0.019	0.129	7dvqY.pdb.gz	Structure of the activated human minor spliceosome.
20	PDB:6ff7X	0.080	0.384	2.569E-5	171	0.032	0.175	6ff7X.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q5JX62	0.0	551	291	0.312	1.000	Q5JX62_HUMAN RNA binding motif protein 12 (Fragment) OS=Homo sapiens OX=9606 GN=RBM12 PE=1 SV=1
2	Q9NTZ6	0.0	1840	932	1.000	1.000	RBM12_HUMAN RNA-binding protein 12 OS=Homo sapiens OX=9606 GN=RBM12 PE=1 SV=1
3	Q8IXT5	5.68e-51	196	1001	0.126	0.117	RB12B_HUMAN RNA-binding protein 12B OS=Homo sapiens OX=9606 GN=RBM12B PE=1 SV=2
4	Q8T3I6	1.11e-25	116	984	0.055	0.052	Q8T3I6_DROME SD09402p OS=Drosophila melanogaster OX=7227 GN=CG7879 PE=2 SV=1
5	Q9W0D6	1.22e-25	116	985	0.055	0.052	Q9W0D6_DROME FI22004p1 OS=Drosophila melanogaster OX=7227 GN=cg7879 PE=1 SV=1
6	Q3US41	1.33e-24	112	680	0.105	0.144	ESRP1_MOUSE Epithelial splicing regulatory protein 1 OS=Mus musculus OX=10090 GN=Esrp1 PE=1 SV=2
7	Q6NXG1	4.46e-24	110	681	0.104	0.142	ESRP1_HUMAN Epithelial splicing regulatory protein 1 OS=Homo sapiens OX=9606 GN=ESRP1 PE=1 SV=2
8	A0A2U3TZN9	5.40e-23	107	604	0.104	0.161	A0A2U3TZN9_HUMAN Epithelial splicing regulatory protein 1 OS=Homo sapiens OX=9606 GN=ESRP1 PE=1 SV=1
9	H0YAK1	3.10e-20	97.1	453	0.108	0.223	H0YAK1_HUMAN G-rich RNA sequence binding factor 1 (Fragment) OS=Homo sapiens OX=9606 GN=GRSF1 PE=1 SV=1
10	Q8C5Q4	4.35e-20	97.1	479	0.068	0.132	GRSF1_MOUSE G-rich sequence factor 1 OS=Mus musculus OX=10090 GN=Grsf1 PE=1 SV=2
11	Q22708	7.74e-20	97.1	618	0.084	0.126	SYM2_CAEEL RNA-binding protein sym-2 OS=Caenorhabditis elegans OX=6239 GN=sym-2 PE=2 SV=3
12	Q12849	9.81e-20	95.9	480	0.086	0.167	GRSF1_HUMAN G-rich sequence factor 1 OS=Homo sapiens OX=9606 GN=GRSF1 PE=1 SV=3
13	Q8K0G8	2.07e-19	95.9	717	0.090	0.117	ESRP2_MOUSE Epithelial splicing regulatory protein 2 OS=Mus musculus OX=10090 GN=Esrp2 PE=1 SV=1
14	Q9H6T0	6.46e-19	94.4	727	0.090	0.116	ESRP2_HUMAN Epithelial splicing regulatory protein 2 OS=Homo sapiens OX=9606 GN=ESRP2 PE=1 SV=1
15	H0Y8R1	6.95e-19	92.4	417	0.086	0.192	H0Y8R1_HUMAN G-rich RNA sequence binding factor 1 (Fragment) OS=Homo sapiens OX=9606 GN=GRSF1 PE=1 SV=1
16	P52597	5.27e-18	89.7	415	0.067	0.149	HNRPF_HUMAN Heterogeneous nuclear ribonucleoprotein F OS=Homo sapiens OX=9606 GN=HNRNPF PE=1 SV=3
17	Q794E4	5.99e-18	89.7	415	0.067	0.149	HNRPF_RAT Heterogeneous nuclear ribonucleoprotein F OS=Rattus norvegicus OX=10116 GN=Hnrnpf PE=1 SV=3
18	Q9Z2X1	5.99e-18	89.7	415	0.067	0.149	HNRPF_MOUSE Heterogeneous nuclear ribonucleoprotein F OS=Mus musculus OX=10090 GN=Hnrnpf PE=1 SV=3
19	Q9BJZ5	6.23e-18	91.7	967	0.065	0.063	FUSIL_DROME RNA-binding protein fusilli OS=Drosophila melanogaster OX=7227 GN=fus PE=2 SV=1
20	Q9VGH5	1.66e-17	89.7	586	0.064	0.102	Q9VGH5_DROME AT27789p OS=Drosophila melanogaster OX=7227 GN=glo PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00076 RRM_1	8.8e-27	104.1	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
2	PF08777 RRM_3	1.9e+02	13.5	RNA binding motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9555.ENSPANP00000016746

Rank	PPI partner	STRING score	Description
1	9555.ENSPANP00000008556	0.755	Coronin, actin binding protein, 1B
2	9555.ENSPANP00000015649	0.739	Checkpoint kinase 2
3	9555.ENSPANP00000010361	0.737	Adenylate cyclase 10 (soluble)
4	9555.ENSPANP00000012719	0.736	AKT interacting protein
5	9555.ENSPANP00000009901	0.718	Myosin IG
6	9555.ENSPANP00000013521	0.713	Involved in the maturation of specific proteins in the endoplasmic reticulum
7	9555.ENSPANP00000012395	0.697	Golgi-associated, gamma adaptin ear containing, ARF binding protein 2
8	9555.ENSPANP00000018207	0.689	ST3 beta-galactoside alpha-2,3-sialyltransferase 2
9	9555.ENSPANP00000016208	0.687	Ubiquitin-conjugating enzyme E2O
10	9555.ENSPANP00000005591	0.675	Protein phosphatase 5, catalytic subunit
11	9555.ENSPANP00000015541	0.673	PRKR interacting protein 1 (IL11 inducible)
12	9555.ENSPANP00000012510	0.667	Coronin, actin binding protein, 1A
13	9555.ENSPANP00000014180	0.667	Coronin, actin binding protein, 2B
14	9555.ENSPANP00000018111	0.667	Coronin, actin binding protein, 1C
15	9555.ENSPANP00000019052	0.667	Coronin, actin binding protein, 2A
16	9555.ENSPANP00000019931	0.667	Coronin 6
17	9555.ENSPANP00000003231	0.664	Serine/threonine kinase 3
18	9555.ENSPANP00000017674	0.664	Stress-activated, pro-apoptotic kinase which, following caspase-cleavage, enters the nucleus and induces chromatin condensation followed by internucleosomal DNA fragmentation. Key component of the Hippo signaling pathway which plays a pivotal role in organ size control and tumor suppression by restricting proliferation and promoting apoptosis. The core of this pathway is composed of a kinase cascade wherein STK3/MST2 and STK4/MST1, in complex with its regulatory protein SAV1, phosphorylates and activates LATS1/2 in complex with its regulatory protein MOB1, which in turn phosphorylates [...]
19	9555.ENSPANP00000003394	0.652	Myosin IH
20	9555.ENSPANP00000004044	0.652	Myosin IA

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.999	biological regulation
GO:0009987	0.994	cellular process
GO:0071704	0.991	organic substance metabolic process
GO:0044238	0.989	primary metabolic process
GO:0050794	0.987	regulation of cellular process
GO:0044237	0.979	cellular metabolic process
GO:0006807	0.971	nitrogen compound metabolic process
GO:0080090	0.966	regulation of primary metabolic process
GO:0051171	0.964	regulation of nitrogen compound metabolic process
GO:0031323	0.961	regulation of cellular metabolic process
GO:0019219	0.954	regulation of nucleobase-containing compound metabolic process
GO:0060255	0.950	regulation of macromolecule metabolic process
GO:1901360	0.939	organic cyclic compound metabolic process
GO:0010468	0.935	regulation of gene expression
GO:0006139	0.934	nucleobase-containing compound metabolic process
GO:0051252	0.928	regulation of RNA metabolic process
GO:0043170	0.920	macromolecule metabolic process
GO:0090304	0.890	nucleic acid metabolic process
GO:0016070	0.857	RNA metabolic process
GO:0010467	0.777	gene expression
GO:0006396	0.729	RNA processing
GO:0048519	0.513	negative regulation of biological process
GO:0048518	0.487	positive regulation of biological process
GO:0050896	0.464	response to stimulus
GO:0048522	0.453	positive regulation of cellular process
GO:0048523	0.425	negative regulation of cellular process
GO:0071840	0.409	cellular component organization or biogenesis
GO:0016043	0.351	cellular component organization
GO:0006397	0.330	mRNA processing

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005737	0.603	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]