StarFunc result for job id Q9NU22

User Input

>input (1400 residues)
MEHFLLEVAAAPLRLIAAKNEKSRSELGRFLAKQVWTPQDRQCVLSTLAQLLLDKDCTVL
VGRQLRPLLLDLLERNAEAIKAGGQINHDLHERLCVSMSKLIGNHPDVLPFALRYFKDTS
PVFQRLFLESSDANPVRYGRRRMKLRDLMEAAFKFLQQEQSVFRELWDWSVCVPLLRSHD
TLVRWYTANCLALVTCMNEEHKLSFLKKIFNSDELIHFRLRLLEEAQLQDLEKALVLANP
EVSLWRKQKELQYLQGHLVSSDLSPRVTAVCGVVLPGQLPAPGELGGNRSSSREQELALR
SYVLVESVCKSLQTLAMAVASQNAVLLEGPIGCGKTSLVEYLAAVTGRTKPPQLLKVQLG
DQTDSKMLLGMYRCTDVPGEFVWQPGTLTQAATMGHWILLEDIDYAPLDVVSVLIPLLEN
GELLIPGRGDCLKVAPGFQFFATRRLLSCGGNWYRPLNSHATLLDKYWTKIHLDNLDKRE
LNEVLQSRYPSLLAVVDHLLDIYIQLTGEKHHSWSDSSVGCEQAPEEVSEARRENKRPTL
EGRELSLRDLLNWCNRIAHSFDSSSLSASLNIFQEALDCFTAMLSEHTSKLKMAEVIGSK
LNISRKKAEFFCQLYKPEIVINELDLQVGRVRLLRKQSEAVHLQREKFTFAATRPSSVLI
EQLAVCVSKGEPVLLVGETGTGKTSTIQYLAHITGHRLRVVNMNQQSDTADLLGGYKPVD
HKLIWLPLREAFEELFAQTFSKKQNFTFLGHIQTCYRQKRWHDLLRLMQHVHKSAVNKDG
KDSETGLLIKEKWEAFGLRLNHAQQQMKMTENTLLFAFVEGTLAQAVKKGEWILLDEINL
AAPEILECLSGLLEGSSGSLVLLDRGDTEPLVRHPDFRLFACMNPATDVGKRNLPPGIRN
RFTELYVEELESKEDLQVLIVDYLKGLSVNKNTVQGIINFYTALRKESGTKLVDGTGHRP
HYSLRTLCRALRFAASNPCGNIQRSLYEGFCLGFLTQLDRASHPIVQKLICQHIVPGNVK
SLLKQPIPEPKGGRLIQVEGYWIAVGDKEPTIDETYILTSSVKLNLRDIVRVVSAGTYPV
LIQGETSVGKTSLIQWLAAATGNHCVRINNHEHTDIQEYIGCYTSDSSGKLVFKEGVLID
AMRKGYWIILDELNLAPTDVLEALNRLLDDNRELLVTETQEVVKAHPRFMLFATQNPPGL
YGGRKVLSRAFRNRFVELHFDELPSSELETILHKRCSLPPSYCSKLVKVMLDLQSYRRSS
SVFAGKQGFITLRDLFRWAERYRLAEPTEKEYDWLQHLANDGYMLLAGRVRKQEEIDVIQ
EVLEKHFKKKLCPQSLFSKENVLKLLGKLSTQISTLECNFGHIVWTEGMRRLAMLVGRAL
EFGEPVLLVGDTGCGKTTIC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:6i26A	0.523	0.228	3.424E-45	3587	0.302	0.118	6i26A.pdb.gz
2	PDB:6or5A	0.523	0.365	8.136E-43	2058	0.284	0.193	6or5A.pdb.gz	Structural Insights into Mdn1, an Essential AAA Protein Required for Ribosome Biogenesis.
3	PDB:5jcss	0.492	0.355	3.260E-41	2003	0.294	0.206	5jcss.pdb.gz	Architecture of the Rix1-Rea1 checkpoint machinery during pre-60S-ribosome remodeling
4	PDB:6i27A	0.459	0.210	8.448E-39	3544	0.284	0.112	6i27A.pdb.gz
5	PDB:6ylfAP1	0.506	0.218	2.183E-34	3629	0.274	0.106	6ylfAP1.pdb.gz
6	AFDB:A3KMH1	0.502	0.379	2.672E-34	1905	0.133	0.098	A3KMH1.pdb.gz	VWA8_HUMAN von Willebrand factor A domain-containing protein 8 OS=Homo sapiens OX=9606 GN=VWA8 PE=1 SV=2
7	AFDB:Q8CC88	0.518	0.391	3.319E-34	1905	0.141	0.103	Q8CC88.pdb.gz	VWA8_MOUSE von Willebrand factor A domain-containing protein 8 OS=Mus musculus OX=10090 GN=Vwa8 PE=1 SV=2
8	AFDB:Q57ZW5	0.518	0.348	2.335E-31	2163	0.122	0.079	Q57ZW5.pdb.gz	Q57ZW5_TRYB2 VWFA domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.26K5.300 PE=4 SV=1
9	PDB:6orbA	0.447	0.198	1.289E-30	3352	0.244	0.102	6orbA.pdb.gz
10	PDB:7mi6A	0.479	0.297	1.739E-27	2419	0.140	0.081	7mi6A.pdb.gz	Targeting allostery in the Dynein motor domain with small molecule inhibitors.
11	PDB:4w8fB	0.490	0.282	6.389E-26	2609	0.125	0.067	4w8fB.pdb.gz	Allosteric communication in the Dynein motor domain.
12	PDB:5nugA	0.493	0.255	9.848E-25	2920	0.144	0.069	5nugA.pdb.gz	Cryo-EM Reveals How Human Cytoplasmic Dynein Is Auto-inhibited and Activated.
13	AFDB:E7FFM4	0.453	0.249	5.274E-24	2685	0.109	0.057	E7FFM4.pdb.gz
14	PDB:7z8gA	0.443	0.228	6.370E-24	3047	0.136	0.062	7z8gA.pdb.gz	Structure of dynein-dynactin on microtubules shows tandem adaptor binding.
15	AFDB:P42762	0.114	0.163	2.268E-11	945	0.099	0.146	P42762.pdb.gz	CLPD_ARATH Chaperone protein ClpD, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CLPD PE=1 SV=1
16	AFDB:Q2G0P5	0.119	0.195	7.650E-11	818	0.077	0.132	Q2G0P5.pdb.gz	CLPC_STAA8 ATP-dependent Clp protease ATP-binding subunit ClpC OS=Staphylococcus aureus (strain NCTC 8325 / PS 47) OX=93061 GN=clpC PE=1 SV=1
17	AFDB:Q6H795	0.116	0.167	9.505E-11	938	0.094	0.141	Q6H795.pdb.gz	CLPD1_ORYSJ Chaperone protein ClpD1, chloroplastic OS=Oryza sativa subsp. japonica OX=39947 GN=CLPD1 PE=2 SV=1
18	AFDB:A0A1D8PTP9	0.124	0.182	1.181E-10	899	0.094	0.147	A0A1D8PTP9.pdb.gz	A0A1D8PTP9_CANAL Chaperone ATPase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=HSP104 PE=1 SV=1
19	AFDB:Q9RA63	0.124	0.192	1.746E-10	854	0.101	0.165	Q9RA63.pdb.gz	CLPB_THET8 Chaperone protein ClpB OS=Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) OX=300852 GN=clpB PE=1 SV=2
20	AFDB:P9WPC9	0.118	0.188	2.470E-10	848	0.081	0.134	P9WPC9.pdb.gz	CLPC1_MYCTU ATP-dependent Clp protease ATP-binding subunit ClpC1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=clpC1 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A1P8AUY4	0.0	813	5400	0.369	0.096	MDN1_ARATH Midasin OS=Arabidopsis thaliana OX=3702 GN=MDN1 PE=1 SV=1
2	O94248	0.0	778	4717	0.339	0.100	MDN1_SCHPO Midasin OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mdn1 PE=1 SV=1
3	Q12019	0.0	863	4910	0.346	0.099	MDN1_YEAST Midasin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MDN1 PE=1 SV=1
4	Q4GZD0	0.0	712	4600	0.313	0.095	Q4GZD0_TRYB2 Midasin OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.880 PE=3 SV=1
5	Q6FIU8	0.0	827	4880	0.336	0.096	Q6FIU8_CANGA Midasin OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=CAGL0M11616g PE=3 SV=1
6	Q9NU22	0.0	2895	5596	1.000	0.250	MDN1_HUMAN Midasin OS=Homo sapiens OX=9606 GN=MDN1 PE=1 SV=2
7	Q8CC88	8.97e-07	56.2	1905	0.097	0.071	VWA8_MOUSE von Willebrand factor A domain-containing protein 8 OS=Mus musculus OX=10090 GN=Vwa8 PE=1 SV=2
8	A3KMH1	1.32e-06	55.8	1905	0.066	0.048	VWA8_HUMAN von Willebrand factor A domain-containing protein 8 OS=Homo sapiens OX=9606 GN=VWA8 PE=1 SV=2
9	Q57ZW5	1.29e-05	52.4	2163	0.024	0.016	Q57ZW5_TRYB2 VWFA domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.26K5.300 PE=4 SV=1
10	Q386R7	6.78e-05	50.1	4307	0.059	0.019	Q386R7_TRYB2 Dynein heavy chain, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.0030 PE=4 SV=1
11	P71922	5.39e-04	46.2	291	0.036	0.175	P71922_MYCTU AAA+ ATPase domain-containing protein OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv2426c PE=1 SV=2
12	A0A1D8PK53	0.015	42.4	4161	0.057	0.019	A0A1D8PK53_CANAL Dynein heavy chain, cytoplasmic OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=DYN1 PE=4 SV=1
13	E9Q0B6	0.033	41.6	4144	0.029	0.010	E9Q0B6_MOUSE Dynein, axonemal, heavy chain 6 OS=Mus musculus OX=10090 GN=Dnah6 PE=1 SV=1
14	E9Q3H7	0.033	41.2	4092	0.029	0.010	E9Q3H7_MOUSE Dynein, axonemal, heavy chain 6 OS=Mus musculus OX=10090 GN=Dnah6 PE=1 SV=1
15	Q9SMH3	0.034	41.2	4625	0.016	0.005	DYH1A_CHLRE Dynein-1-alpha heavy chain, flagellar inner arm I1 complex OS=Chlamydomonas reinhardtii OX=3055 GN=DHC1 PE=1 SV=1
16	Q75GT3	0.060	40.4	978	0.028	0.040	CLPB2_ORYSJ Chaperone protein ClpB2, chloroplastic OS=Oryza sativa subsp. japonica OX=39947 GN=CLPB2 PE=2 SV=1
17	Q9P225	0.077	40.0	4427	0.032	0.010	DYH2_HUMAN Dynein axonemal heavy chain 2 OS=Homo sapiens OX=9606 GN=DNAH2 PE=1 SV=3
18	Q9RA63	0.080	40.0	854	0.026	0.043	CLPB_THET8 Chaperone protein ClpB OS=Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8) OX=300852 GN=clpB PE=1 SV=2
19	Q50701	0.096	38.9	251	0.025	0.139	Y3427_MYCTU Putative ATP-binding protein Rv3427c in insertion sequence OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv3427c PE=3 SV=1
20	O95342	0.12	39.3	1321	0.016	0.017	ABCBB_HUMAN Bile salt export pump OS=Homo sapiens OX=9606 GN=ABCB11 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00004 AAA	2.5e-10	52.3	ATPase family associated with various cellular activities (AAA)
2	PF13086 AAA_11	9	17.6	AAA domain
3	PF13173 AAA_14	6.7e-07	40.8	AAA domain
4	PF13191 AAA_16	8.5e-13	60.5	AAA ATPase domain
5	PF13238 AAA_18	0.00037	32.5	AAA domain
6	PF13245 AAA_19	0.91	21.2	AAA domain
7	PF13401 AAA_22	0.0029	29.3	AAA domain
8	PF13476 AAA_23	4.7e-07	42.1	AAA domain
9	PF13479 AAA_24	3.4e+02	12.3	AAA domain
10	PF13481 AAA_25	0.0073	27.4	AAA domain
11	PF13521 AAA_28	21	16.8	AAA domain
12	PF13555 AAA_29	0.00054	31.0	P-loop containing region of AAA domain
13	PF07726 AAA_3	4.6e-10	50.9	ATPase family associated with various cellular activities (AAA)
14	PF13604 AAA_30	0.01	27.1	AAA domain
15	PF13671 AAA_33	16	17.1	AAA domain
16	PF07728 AAA_5	3.2e-61	216.8	AAA domain (dynein-related subfamily)
17	PF12774 AAA_6	0.00055	30.6	Hydrolytic ATP binding site of dynein motor region
18	PF12775 AAA_7	3.4e-13	61.0	P-loop containing dynein motor region
19	PF12780 AAA_8	32	15.2	P-loop containing dynein motor region D4
20	PF17865 AAA_lid_5	1.7e-27	106.9	Midasin AAA lid domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000358400

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000261015	0.990	Ribosome biogenesis protein WDR12
2	9606.ENSP00000413572	0.984	Notchless protein homolog 1
3	9606.ENSP00000362153	0.980	Nucleolar GTP-binding protein 2
4	9606.ENSP00000364037	0.963	Testis-expressed protein 10
5	9606.ENSP00000476117	0.963	WD repeat-containing protein 18
6	9606.ENSP00000483484	0.956	Ribosome biogenesis protein NSA2 homolog
7	9606.ENSP00000364320	0.947	mRNA turnover protein 4 homolog
8	9606.ENSP00000432119	0.946	WD repeat-containing protein 74
9	9606.ENSP00000348596	0.940	Protein SDA1 homolog
10	9606.ENSP00000346725	0.931	Pescadillo homolog
11	9606.ENSP00000354040	0.931	Nucleolar GTP-binding protein 1
12	9606.ENSP00000455106	0.929	Ribosome biogenesis protein BOP1
13	9606.ENSP00000358812	0.928	Protein RRP5 homolog
14	9606.ENSP00000260443	0.915	Probable ribosome biogenesis protein RLP24
15	9606.ENSP00000363574	0.892	Eukaryotic translation initiation factor 6
16	9606.ENSP00000396673	0.877	pre-rRNA processing protein FTSJ3
17	9606.ENSP00000355541	0.873	HEAT repeat-containing protein 1
18	9606.ENSP00000261637	0.861	Small subunit processome component 20 homolog
19	9606.ENSP00000402338	0.856	Ribosome production factor 2 homolog
20	9606.ENSP00000281701	0.854	Nuclear valosin-containing protein-like

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0140657	0.977	ATP-dependent activity
GO:0003824	0.931	catalytic activity
GO:0016787	0.903	hydrolase activity
GO:0016887	0.829	ATP hydrolysis activity
GO:1901363	0.585	heterocyclic compound binding
GO:0097159	0.585	organic cyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0022618	0.971	ribonucleoprotein complex assembly
GO:0140694	0.968	non-membrane-bounded organelle assembly
GO:0000027	0.960	ribosomal large subunit assembly

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.997	nucleus
GO:0043232	0.994	intracellular non-membrane-bounded organelle
GO:0031981	0.993	nuclear lumen
GO:0005737	0.981	cytoplasm
GO:0005654	0.961	nucleoplasm
GO:0016020	0.923	membrane
GO:0005829	0.919	cytosol
GO:0005856	0.894	cytoskeleton
GO:0005730	0.828	nucleolus
GO:0045111	0.538	intermediate filament cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.903	Hydrolases.
RHEA:13065	0.829	ATP + H2O = ADP + H(+) + phosphate

[back to server]