StarFunc result for job id Q9NU39

User Input

>input (408 residues)
MNLPRAERPRSTPQRSLRDSDGEDGKIDVLGEEEDEDEVEDEEEEASQKFLEQSLQPGLQ
VARWGGVALPREHIEGGGPSDPSEFGTEFRAPPRSAAASEDARQPAKPPYSYIALITMAI
LQSPHKRLTLSGICAFISGRFPYYRRKFPAWQNSIRHNLSLNDCFVKIPREPGHPGKGTY
WSLDPASQDMFDNGSFLRRRKRFKRHQLTPGAHLPHPFPLPAAHAALHNPRPGPLLGAPA
LPQPVPGAYPNTAPGRRPYALLHPHPPRYLLLSAPAYAGAPKKAEGADLATPGTLPVLQP
SLGPQPWEEGKGLASPPGGGCISFSIESIMQGVRGAGTGAAQSLSPTAWSYCPLLQRPSS
LSDNFAATAAASGGGLRQRLRSHQGRGAGRAPVGRVGAAAVSGGGRGL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NU39	0.999	0.999	2.162E-65	408	1.000	1.000	Q9NU39.pdb.gz	FX4L1_HUMAN Forkhead box protein D4-like 1 OS=Homo sapiens OX=9606 GN=FOXD4L1 PE=1 SV=1
2	AFDB:Q3SYB3	0.384	0.376	4.242E-46	417	0.733	0.717	Q3SYB3.pdb.gz	FX4L6_HUMAN Forkhead box protein D4-like 6 OS=Homo sapiens OX=9606 GN=FOXD4L6 PE=1 SV=2
3	AFDB:Q12950	0.354	0.331	3.319E-45	439	0.730	0.679	Q12950.pdb.gz	FOXD4_HUMAN Forkhead box protein D4 OS=Homo sapiens OX=9606 GN=FOXD4 PE=1 SV=4
4	AFDB:Q16676	0.298	0.265	2.412E-23	465	0.414	0.363	Q16676.pdb.gz	FOXD1_HUMAN Forkhead box protein D1 OS=Homo sapiens OX=9606 GN=FOXD1 PE=1 SV=1
5	AFDB:Q9PSY4	0.271	0.320	2.995E-21	345	0.358	0.423	Q9PSY4.pdb.gz	FOXD1_XENLA Forkhead box protein D1 OS=Xenopus laevis OX=8355 GN=foxd1 PE=2 SV=2
6	AFDB:Q9QY14	0.262	0.369	2.875E-19	288	0.277	0.392	Q9QY14.pdb.gz	FOXE3_MOUSE Forkhead box protein E3 OS=Mus musculus OX=10090 GN=Foxe3 PE=1 SV=1
7	AFDB:Q61574	0.282	0.347	7.631E-18	329	0.267	0.331	Q61574.pdb.gz	FOXS1_MOUSE Forkhead box protein S1 OS=Mus musculus OX=10090 GN=Foxs1 PE=2 SV=2
8	AFDB:E7FER3	0.241	0.229	9.986E-17	429	0.260	0.247	E7FER3.pdb.gz	E7FER3_DANRE Forkhead box F2b OS=Danio rerio OX=7955 GN=foxf2b PE=4 SV=1
9	AFDB:O54743	0.264	0.242	1.566E-16	446	0.301	0.276	O54743.pdb.gz	FOXF2_MOUSE Forkhead box protein F2 OS=Mus musculus OX=10090 GN=Foxf2 PE=2 SV=2
10	AFDB:B0ZTD4	0.261	0.231	5.313E-16	463	0.275	0.242	B0ZTD4.pdb.gz	B0ZTD4_HUMAN Forkhead box A2 OS=Homo sapiens OX=9606 GN=FOXA2 PE=4 SV=1
11	PDB:2hdcA	0.200	0.678	1.744E-11	97	0.211	0.887	2hdcA.pdb.gz	Dynamic DNA contacts observed in the NMR structure of winged helix protein-DNA complex.
12	PDB:5k1yD	0.133	0.475	4.473E-2	92	0.037	0.163	5k1yD.pdb.gz	Detailed structural analysis of AspA-DNA contacts
13	PDB:4a6dA	0.136	0.158	6.578E-2	345	0.025	0.029	4a6dA.pdb.gz	Crystal Structure and Functional Mapping of Human Asmt, the Last Enzyme of the Melatonin Synthesis Pathway.
14	PDB:2nyxB	0.143	0.351	1.032E-1	147	0.025	0.068	2nyxB.pdb.gz
15	PDB:2fe3B	0.132	0.342	1.334E-1	143	0.022	0.063	2fe3B.pdb.gz	Crystal structure of the apo-PerR-Zn protein from Bacillus subtilis.
16	PDB:6iwtA	0.148	0.171	1.517E-1	346	0.034	0.040	6iwtA.pdb.gz
17	PDB:7k5yU	0.146	0.610	1.517E-1	75	0.025	0.133	7k5yU.pdb.gz	Distinct Structures and Dynamics of Chromatosomes with Different Human Linker Histone Isoforms.
18	PDB:3euhB	0.171	0.212	1.962E-1	321	0.020	0.025	3euhB.pdb.gz
19	PDB:5hs7A	0.128	0.400	2.092E-1	102	0.032	0.127	5hs7A.pdb.gz
20	PDB:2fxaB	0.136	0.279	2.231E-1	180	0.029	0.067	2fxaB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q12950	0.0	534	439	0.684	0.636	FOXD4_HUMAN Forkhead box protein D4 OS=Homo sapiens OX=9606 GN=FOXD4 PE=1 SV=4
2	Q3SYB3	0.0	513	417	0.696	0.681	FX4L6_HUMAN Forkhead box protein D4-like 6 OS=Homo sapiens OX=9606 GN=FOXD4L6 PE=1 SV=2
3	Q6VB84	0.0	516	417	0.699	0.683	FX4L3_HUMAN Forkhead box protein D4-like 3 OS=Homo sapiens OX=9606 GN=FOXD4L3 PE=1 SV=2
4	Q8WXT5	0.0	515	416	0.699	0.685	FX4L4_HUMAN Forkhead box protein D4-like 4 OS=Homo sapiens OX=9606 GN=FOXD4L4 PE=1 SV=2
5	Q9NU39	0.0	815	408	1.000	1.000	FX4L1_HUMAN Forkhead box protein D4-like 1 OS=Homo sapiens OX=9606 GN=FOXD4L1 PE=1 SV=1
6	Q9DEN4	3.47e-57	193	371	0.252	0.278	FXD3A_XENLA Forkhead box protein D3-A OS=Xenopus laevis OX=8355 GN=foxd3-a PE=1 SV=1
7	Q9DEN3	6.76e-56	190	371	0.243	0.267	FXD3B_XENLA Forkhead box protein D3-B OS=Xenopus laevis OX=8355 GN=foxd3-b PE=2 SV=1
8	Q18694	9.03e-55	186	333	0.223	0.273	UN130_CAEEL Forkhead box protein unc-130 OS=Caenorhabditis elegans OX=6239 GN=unc-130 PE=1 SV=1
9	Q9PRJ8	1.90e-54	186	352	0.321	0.372	FXD5A_XENLA Forkhead box protein D5-A OS=Xenopus laevis OX=8355 GN=foxd5-a PE=2 SV=1
10	F1R5S7	1.29e-53	184	371	0.279	0.307	F1R5S7_DANRE Forkhead box protein D3 OS=Danio rerio OX=7955 GN=fkd-6 PE=1 SV=1
11	Q9PT68	9.48e-53	181	353	0.240	0.278	FXD5B_XENLA Forkhead box protein D5-B OS=Xenopus laevis OX=8355 GN=foxd5-b PE=2 SV=1
12	P79772	2.63e-52	181	394	0.223	0.231	FOXD3_CHICK Forkhead box protein D3 OS=Gallus gallus OX=9031 GN=FOXD3 PE=2 SV=1
13	Q61060	4.33e-52	182	465	0.223	0.196	FOXD3_MOUSE Forkhead box protein D3 OS=Mus musculus OX=10090 GN=Foxd3 PE=2 SV=3
14	O73784	5.17e-52	178	321	0.201	0.255	O73784_DANRE Fork head domain protein FKD8 OS=Danio rerio OX=7955 GN=fkd8 PE=2 SV=1
15	Q9UJU5	1.62e-51	181	478	0.223	0.190	FOXD3_HUMAN Forkhead box protein D3 OS=Homo sapiens OX=9606 GN=FOXD3 PE=1 SV=1
16	Q63245	2.06e-51	169	101	0.194	0.782	FOXD3_RAT Forkhead box protein D3 (Fragment) OS=Rattus norvegicus OX=10116 GN=Foxd3 PE=1 SV=1
17	Q16676	2.03e-50	178	465	0.196	0.172	FOXD1_HUMAN Forkhead box protein D1 OS=Homo sapiens OX=9606 GN=FOXD1 PE=1 SV=1
18	Q9PSY4	3.89e-50	174	345	0.191	0.226	FOXD1_XENLA Forkhead box protein D1 OS=Xenopus laevis OX=8355 GN=foxd1 PE=2 SV=2
19	Q61345	4.64e-50	177	456	0.194	0.173	FOXD1_MOUSE Forkhead box protein D1 OS=Mus musculus OX=10090 GN=Foxd1 PE=2 SV=2
20	O60548	5.19e-50	177	495	0.196	0.162	FOXD2_HUMAN Forkhead box protein D2 OS=Homo sapiens OX=9606 GN=FOXD2 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00250 Forkhead	1.1e-32	123.3	Forkhead domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000302756

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000365514	0.599	Zinc finger protein ZIC 2
2	9606.ENSP00000287538	0.537	Zinc finger protein ZIC 3
3	9606.ENSP00000365720	0.529	Transducin-like enhancer protein 4
4	9606.ENSP00000474988	0.517	Trophoblast glycoprotein like

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003677	0.996	DNA binding
GO:0043565	0.984	sequence-specific DNA binding
GO:0003700	0.969	DNA-binding transcription factor activity
GO:0003690	0.945	double-stranded DNA binding
GO:1990837	0.943	sequence-specific double-stranded DNA binding
GO:0000976	0.911	transcription cis-regulatory region binding
GO:0000981	0.783	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000977	0.454	RNA polymerase II transcription regulatory region sequence-specific DNA binding
GO:0000987	0.413	cis-regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0007275	0.996	multicellular organism development
GO:0048731	0.986	system development
GO:0050789	0.973	regulation of biological process
GO:0050794	0.948	regulation of cellular process
GO:0048513	0.920	animal organ development
GO:0019222	0.828	regulation of metabolic process
GO:0010468	0.820	regulation of gene expression
GO:0009889	0.760	regulation of biosynthetic process
GO:0031323	0.760	regulation of cellular metabolic process
GO:0006355	0.749	regulation of DNA-templated transcription
GO:0007399	0.623	nervous system development
GO:0009987	0.592	cellular process
GO:0006357	0.538	regulation of transcription by RNA polymerase II
GO:0009888	0.492	tissue development
GO:0048519	0.479	negative regulation of biological process
GO:0048523	0.467	negative regulation of cellular process
GO:0048518	0.388	positive regulation of biological process
GO:0048522	0.356	positive regulation of cellular process
GO:0007417	0.308	central nervous system development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005654	0.974	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]