StarFunc result for job id Q9NU63

User Input

>input (452 residues)
MAAGEPRSLLFFQKPVTFEDVAVNFTQEEWDCLDASQRVLYQDVMSETFKNLTSVARIFL
HKPELITKLEQEEEQWRETRVLQASQAGPPFFCYTCGKCFSRRSYLYSHQFVHNPKLTNS
CSQCGKLFRSPKSLSYHRRMHLGERPFCCTLCDKTYCDASGLSRHRRVHLGYRPHSCSVC
GKSFRDQSELKRHQKIHQNQEPVDGNQECTLRIPGTQAEFQTPIARSQRSIQGLLDVNHA
PVARSQEPIFRTEGPMAQNQASVLKNQAPVTRTQAPITGTLCQDARSNSHPVKPSRLNVF
CCPHCSLTFSKKSYLSRHQKAHLTEPPNYCFHCSKSFSSFSRLVRHQQTHWKQKSYLCPI
CDLSFGEKEGLMDHWRGYKGKDLCQSSHHKCRVILGQWLGFSHDVPTMAGEEWKHGGDQS
PPRIHTPRRRGLREKACKGDKTKEAVSILKHK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NU63	1.000	1.000	6.505E-78	452	1.000	1.000	Q9NU63.pdb.gz	ZFP57_HUMAN Zinc finger protein 57 homolog OS=Homo sapiens OX=9606 GN=ZFP57 PE=1 SV=2
2	AFDB:E9Q981	0.195	0.144	1.333E-20	636	0.250	0.178	E9Q981.pdb.gz	E9Q981_MOUSE Zinc finger protein 976 OS=Mus musculus OX=10090 GN=Zfp976 PE=4 SV=1
3	AFDB:Q15973	0.204	0.257	2.897E-20	351	0.254	0.328	Q15973.pdb.gz	ZN124_HUMAN Zinc finger protein 124 OS=Homo sapiens OX=9606 GN=ZNF124 PE=1 SV=2
4	AFDB:Q8NCK3	0.190	0.193	3.679E-20	441	0.261	0.268	Q8NCK3.pdb.gz	ZN485_HUMAN Zinc finger protein 485 OS=Homo sapiens OX=9606 GN=ZNF485 PE=1 SV=1
5	AFDB:Q8TAQ5	0.230	0.169	7.095E-20	688	0.248	0.163	Q8TAQ5.pdb.gz	ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens OX=9606 GN=ZNF420 PE=1 SV=1
6	AFDB:Q8CIP9	0.190	0.306	1.078E-19	271	0.226	0.376	Q8CIP9.pdb.gz	Q8CIP9_MOUSE KRAB zinc finger protein 6D (Fragment) OS=Mus musculus OX=10090 GN=Zfp640 PE=2 SV=1
7	AFDB:A0A0U1RQ46	0.189	0.150	1.958E-19	609	0.246	0.182	A0A0U1RQ46.pdb.gz	A0A0U1RQ46_MOUSE Zinc finger protein 950 OS=Mus musculus OX=10090 GN=Zfp950 PE=4 SV=1
8	AFDB:P17030	0.258	0.256	2.078E-19	456	0.254	0.252	P17030.pdb.gz	ZNF25_HUMAN Zinc finger protein 25 OS=Homo sapiens OX=9606 GN=ZNF25 PE=1 SV=2
9	AFDB:Q8IYN0	0.261	0.227	2.486E-19	542	0.243	0.203	Q8IYN0.pdb.gz	ZN100_HUMAN Zinc finger protein 100 OS=Homo sapiens OX=9606 GN=ZNF100 PE=1 SV=2
10	AFDB:Q8BKK5	0.195	0.178	2.974E-19	500	0.246	0.222	Q8BKK5.pdb.gz	ZN689_MOUSE Zinc finger protein 689 OS=Mus musculus OX=10090 GN=Znf689 PE=2 SV=1
11	PDB:3w5kB	0.125	0.347	2.474E-3	110	0.075	0.309	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
12	PDB:6vp9B	0.083	0.050	6.777E-1	914	0.035	0.018	6vp9B.pdb.gz	Molecular basis for N-terminal alpha-synuclein acetylation by human NatB.
13	PDB:5dkaA	0.060	0.223	1.231	96	0.035	0.167	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
14	PDB:6o9lQ	0.060	0.063	1.563	430	0.073	0.077	6o9lQ.pdb.gz	Transcription preinitiation complex structure and dynamics provide insight into genetic diseases.
15	PDB:6qlfU	0.062	0.116	2.521	171	0.060	0.158	6qlfU.pdb.gz
16	PDB:5n5yI	0.037	0.117	3.607	99	0.042	0.192	5n5yI.pdb.gz	Structural Basis of RNA Polymerase I Transcription Initiation.
17	PDB:7obqu	0.105	0.107	3.829	441	0.060	0.061	7obqu.pdb.gz	Molecular mechanism of cargo recognition and handover by the mammalian signal recognition particle.
18	PDB:6r5kO	0.060	0.060	4.314	447	0.042	0.043	6r5kO.pdb.gz	Molecular Basis for poly(A) RNP Architecture and Recognition by the Pan2-Pan3 Deadenylase.
19	PDB:5m32k	0.062	0.074	4.580	364	0.038	0.047	5m32k.pdb.gz	Long-range allosteric regulation of the human 26S proteasome by 20S proteasome-targeting cancer drugs.
20	PDB:7pzyL	0.063	0.177	5.161	93	0.011	0.054	7pzyL.pdb.gz	E-site drug specificity of the human pathogen Candida albicans ribosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9NU63	0.0	942	452	1.000	1.000	ZFP57_HUMAN Zinc finger protein 57 homolog OS=Homo sapiens OX=9606 GN=ZFP57 PE=1 SV=2
2	Q8C6P8	8.61e-77	247	421	0.369	0.397	ZFP57_MOUSE Zinc finger protein 57 OS=Mus musculus OX=10090 GN=Zfp57 PE=1 SV=1
3	Q8N988	1.73e-48	173	423	0.285	0.305	ZN557_HUMAN Zinc finger protein 557 OS=Homo sapiens OX=9606 GN=ZNF557 PE=1 SV=2
4	Q8NCK3	7.66e-48	172	441	0.299	0.306	ZN485_HUMAN Zinc finger protein 485 OS=Homo sapiens OX=9606 GN=ZNF485 PE=1 SV=1
5	Q8TAQ5	1.84e-46	172	688	0.279	0.183	ZN420_HUMAN Zinc finger protein 420 OS=Homo sapiens OX=9606 GN=ZNF420 PE=1 SV=1
6	Q9C0F3	3.82e-46	168	470	0.290	0.279	ZN436_HUMAN Zinc finger protein 436 OS=Homo sapiens OX=9606 GN=ZNF436 PE=1 SV=2
7	Q3KNS6	2.13e-45	165	432	0.270	0.282	ZN829_HUMAN Zinc finger protein 829 OS=Homo sapiens OX=9606 GN=ZNF829 PE=1 SV=1
8	A0A0U1RQ46	2.42e-45	168	609	0.283	0.210	A0A0U1RQ46_MOUSE Zinc finger protein 950 OS=Mus musculus OX=10090 GN=Zfp950 PE=4 SV=1
9	Q96NG5	4.79e-43	158	402	0.259	0.291	ZN558_HUMAN Zinc finger protein 558 OS=Homo sapiens OX=9606 GN=ZNF558 PE=1 SV=1
10	Q15973	1.43e-41	153	351	0.237	0.305	ZN124_HUMAN Zinc finger protein 124 OS=Homo sapiens OX=9606 GN=ZNF124 PE=1 SV=2
11	Q14585	2.85e-41	155	488	0.217	0.201	ZN345_HUMAN Zinc finger protein 345 OS=Homo sapiens OX=9606 GN=ZNF345 PE=1 SV=1
12	E9QAG8	2.87e-41	155	526	0.246	0.211	ZN431_MOUSE Zinc finger protein 431 OS=Mus musculus OX=10090 GN=Znf431 PE=1 SV=1
13	A0A087WSF4	1.11e-40	155	635	0.270	0.192	A0A087WSF4_MOUSE Zinc finger protein 976 OS=Mus musculus OX=10090 GN=Zfp976 PE=4 SV=1
14	E9Q981	1.15e-40	155	636	0.270	0.192	E9Q981_MOUSE Zinc finger protein 976 OS=Mus musculus OX=10090 GN=Zfp976 PE=4 SV=1
15	P17031	1.85e-40	154	533	0.274	0.233	ZNF26_HUMAN Zinc finger protein 26 OS=Homo sapiens OX=9606 GN=ZNF26 PE=1 SV=3
16	P52738	5.04e-40	151	457	0.274	0.271	ZN140_HUMAN Zinc finger protein 140 OS=Homo sapiens OX=9606 GN=ZNF140 PE=1 SV=2
17	Q9BSG1	6.40e-40	150	425	0.288	0.306	ZNF2_HUMAN Zinc finger protein 2 OS=Homo sapiens OX=9606 GN=ZNF2 PE=1 SV=5
18	Q96NJ6	8.79e-40	151	502	0.241	0.217	ZFP3_HUMAN Zinc finger protein 3 homolog OS=Homo sapiens OX=9606 GN=ZFP3 PE=1 SV=1
19	P51523	2.38e-39	152	738	0.223	0.137	ZNF84_HUMAN Zinc finger protein 84 OS=Homo sapiens OX=9606 GN=ZNF84 PE=1 SV=2
20	Q4V8A8	4.46e-39	151	633	0.219	0.156	ZFP90_RAT Zinc finger protein 90 OS=Rattus norvegicus OX=10116 GN=Zfp90 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01722 BolA	39	16.0	BolA-like protein
2	PF19126 DUF5810	4.2e+02	12.5	Family of unknown function (DUF5810)
3	PF01352 KRAB	5.7e-19	78.8	KRAB box
4	PF00096 zf-C2H2	2.1e-21	86.2	Zinc finger, C2H2 type
5	PF13894 zf-C2H2_4	7.5e-18	74.7	C2H2-type zinc finger
6	PF13912 zf-C2H2_6	68	14.9	C2H2-type zinc finger
7	PF12171 zf-C2H2_jaz	1.4	20.5	Zinc-finger double-stranded RNA-binding
8	PF05605 zf-Di19	67	15.2	Drought induced 19 protein (Di19), zinc-binding
9	PF13465 zf-H2C2_2	2.4e-12	57.9	Zinc-finger double domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000418259

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000253024	0.983	Transcription intermediary factor 1-beta
2	9606.ENSP00000352516	0.850	DNA (cytosine-5)-methyltransferase 1
3	9606.ENSP00000271640	0.790	Histone-lysine N-methyltransferase SETDB1
4	9606.ENSP00000264709	0.757	DNA (cytosine-5)-methyltransferase 3A
5	9606.ENSP00000182290	0.746	Tetraspanin-32
6	9606.ENSP00000328547	0.732	DNA (cytosine-5)-methyltransferase 3B
7	9606.ENSP00000366095	0.730	Myelin-oligodendrocyte glycoprotein
8	9606.ENSP00000283309	0.676	FERM domain containing 1
9	9606.ENSP00000406084	0.675	WD repeat-containing protein 20
10	9606.ENSP00000382972	0.664	Small nuclear ribonucleoprotein-associated protein N
11	9606.ENSP00000307741	0.662	CKLF like MARVEL transmembrane domain containing 8
12	9606.ENSP00000321544	0.642	Kelch repeat and BTB domain containing 11
13	9606.ENSP00000404220	0.618	Protein KASH5
14	9606.ENSP00000270172	0.616	DNA (cytosine-5)-methyltransferase 3-like
15	9606.ENSP00000339250	0.607	Developmental pluripotency-associated protein 3
16	9606.ENSP00000359392	0.606	KHDC3-like protein
17	9606.ENSP00000355613	0.605	Tripartite motif-containing protein 67
18	9606.ENSP00000314153	0.602	Transcriptional regulator Kaiso
19	9606.ENSP00000467123	0.570	NACHT, LRR and PYD domains-containing protein 7
20	9606.ENSP00000445135	0.563	NACHT, LRR and PYD domains-containing protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003682	0.998	chromatin binding
GO:1901363	0.771	heterocyclic compound binding
GO:0097159	0.771	organic cyclic compound binding
GO:0003676	0.745	nucleic acid binding
GO:0003677	0.666	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.986	regulation of biological process
GO:0009987	0.957	cellular process
GO:0019222	0.895	regulation of metabolic process
GO:0060255	0.886	regulation of macromolecule metabolic process
GO:0010468	0.879	regulation of gene expression
GO:0071704	0.874	organic substance metabolic process
GO:0044237	0.873	cellular metabolic process
GO:0044238	0.853	primary metabolic process
GO:0006807	0.852	nitrogen compound metabolic process
GO:0051171	0.845	regulation of nitrogen compound metabolic process
GO:0080090	0.840	regulation of primary metabolic process
GO:0032502	0.836	developmental process
GO:0031323	0.835	regulation of cellular metabolic process
GO:0032501	0.825	multicellular organismal process
GO:0043170	0.813	macromolecule metabolic process
GO:0019219	0.743	regulation of nucleobase-containing compound metabolic process
GO:0031326	0.697	regulation of cellular biosynthetic process
GO:0051252	0.695	regulation of RNA metabolic process
GO:2001141	0.693	regulation of RNA biosynthetic process
GO:0048519	0.691	negative regulation of biological process
GO:0006355	0.674	regulation of DNA-templated transcription
GO:1901360	0.664	organic cyclic compound metabolic process
GO:0034641	0.663	cellular nitrogen compound metabolic process
GO:0006725	0.659	cellular aromatic compound metabolic process
GO:0044260	0.659	cellular macromolecule metabolic process
GO:0046483	0.655	heterocycle metabolic process
GO:0090304	0.654	nucleic acid metabolic process
GO:0048856	0.550	anatomical structure development
GO:0048523	0.541	negative regulation of cellular process
GO:0010605	0.508	negative regulation of macromolecule metabolic process
GO:0031324	0.398	negative regulation of cellular metabolic process
GO:0051172	0.383	negative regulation of nitrogen compound metabolic process
GO:0043412	0.328	macromolecule modification

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0070013	0.507	intracellular organelle lumen
GO:0031981	0.503	nuclear lumen
GO:0005654	0.404	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]