StarFunc result for job id Q9NUA8

User Input

>input (1239 residues)
MELPNYSRQLLQQLYTLCKEQQFCDCTISIGTIYFRAHKLVLAAASLLFKTLLDNTDTIS
IDASVVSPEEFALLLEMMYTGKLPVGKHNFSKIISLADSLQMFDVAVSCKNLLTSLVNCS
VQGQVVRDVSAPSSETFRKEPEKPQVEILSSEGAGEPHSSPELAATPGGPVKAETEEAAH
SVSQEMSVNSPTAQESQRNAETPAETPTTAEACSPSPAVQTFSEAKKTSTEPGCERKHYQ
LNFLLENEGVFSDALMVTQDVLKKLEMCSEIKGPQKEMIVKCFEGEGGHSAFQRILGKVR
EESLDVQTVVSLLRLYQYSNPAVKTALLDRKPEDVDTVQPKGSTEEGKTLSVLLLEHKED
LIQCVTQLRPIMESLETAKEEFLTGTEKRVILNCCEGRTPKETIENLLHRMTEEKTLTAE
GLVKLLQAVKTTFPNLGLLLEKLQKSATLPSTTVQPSPDDYGTELLRRYHENLSEIFTDN
QILLKMISHMTSLAPGEREVMEKLVKRDSGSGGFNSLISAVLEKQTLSATAIWQLLLVVQ
ETKTCPLDLLMEEIRREPGADAFFRAVTTPEHATLETILRHNQLILEAIQQKIEYKLFTS
EEEHLAETVKEILSIPSETASPEASLRAVLSRAMEKSVPAIEICHLLCSVHKSFPGLQPV
MQELAYIGVLTKEDGEKETWKVSNKFHLEANNKEDEKAAKEDSQPGEQNDQGETGSLPGQ
QEKEASASPDPAKKSFICKACDKSFHFYCRLKVHMKRCRVAKSKQVQCKECSETKDSKKE
LDKHQLEAHGAGGEPDAPKKKKKRLPVTCDLCGREFAHASGMQYHKLTEHFDEKPFSCEE
CGAKFAANSTLKNHLRLHTGDRPFMCKHCLMTFTQASALAYHTKKKHSEGKMYACQYCDA
VFAQSIELSRHVRTHTGDKPYVCRDCGKGFRQANGLSIHLHTFHNIEDPYDCKKCRMSFP
TLQDHRKHIHEVHSKEYHPCPTCGKIFSAPSMLERHVVTHVGGKPFSCGICNKAYQQLSG
LWYHNRTHHPDVFAAQNHRSSKFSSLQCSSCDKTFPNTIEHKKHIKAEHADMKFHECDQC
KELFPTPALLQVHVKCQHSGSQPFRCLYCAATFRFPGALQHHVTTEHFKQSETTFPCELC
GELFTSQAQLDSHLESEHPKVMSTETQAAASQMAQVIQTPEPVAPTEQVITLEETQLAGS
QVFVTLPDSQASQASSELVAVTVEDLLDGTVTLICGEAK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NUA8	1.000	1.000	0.000	1239	1.000	1.000	Q9NUA8.pdb.gz	ZBT40_HUMAN Zinc finger and BTB domain-containing protein 40 OS=Homo sapiens OX=9606 GN=ZBTB40 PE=1 SV=4
2	AFDB:Q13105	0.125	0.178	5.960E-25	803	0.174	0.269	Q13105.pdb.gz	ZBT17_HUMAN Zinc finger and BTB domain-containing protein 17 OS=Homo sapiens OX=9606 GN=ZBTB17 PE=1 SV=3
3	AFDB:F1RAC1	0.131	0.140	3.927E-23	1146	0.162	0.175	F1RAC1.pdb.gz	F1RAC1_DANRE Zinc finger and BTB domain-containing 11 OS=Danio rerio OX=7955 GN=ZNF-U69274 PE=4 SV=1
4	AFDB:O95625	0.089	0.101	4.385E-22	1053	0.156	0.183	O95625.pdb.gz	ZBT11_HUMAN Zinc finger and BTB domain-containing protein 11 OS=Homo sapiens OX=9606 GN=ZBTB11 PE=1 SV=2
5	AFDB:Q6ZN55	0.119	0.156	2.061E-21	896	0.114	0.157	Q6ZN55.pdb.gz	ZN574_HUMAN Zinc finger protein 574 OS=Homo sapiens OX=9606 GN=ZNF574 PE=1 SV=2
6	AFDB:O75290	0.111	0.200	4.677E-21	641	0.105	0.203	O75290.pdb.gz	Z780A_HUMAN Zinc finger protein 780A OS=Homo sapiens OX=9606 GN=ZNF780A PE=1 SV=3
7	AFDB:P17027	0.111	0.199	5.362E-21	643	0.105	0.202	P17027.pdb.gz	ZNF23_HUMAN Zinc finger protein 23 OS=Homo sapiens OX=9606 GN=ZNF23 PE=1 SV=3
8	AFDB:A0A024R4S7	0.119	0.177	1.460E-20	792	0.114	0.178	A0A024R4S7.pdb.gz
9	AFDB:Q14587	0.090	0.109	1.460E-20	947	0.131	0.171	Q14587.pdb.gz	ZN268_HUMAN Zinc finger protein 268 OS=Homo sapiens OX=9606 GN=ZNF268 PE=1 SV=2
10	AFDB:Q9UJW8	0.128	0.210	1.358E-19	692	0.125	0.224	Q9UJW8.pdb.gz	ZN180_HUMAN Zinc finger protein 180 OS=Homo sapiens OX=9606 GN=ZNF180 PE=1 SV=2
11	PDB:6wcqC	0.083	0.620	5.939E-4	130	0.025	0.238	6wcqC.pdb.gz
12	PDB:3w5kB	0.043	0.241	5.046E-3	110	0.032	0.364	3w5kB.pdb.gz	Structural basis for the selective nuclear import of the C2H2 zinc-finger protein Snail by importin beta.
13	PDB:4a2wA	0.059	0.103	7.747E-2	678	0.027	0.050	4a2wA.pdb.gz
14	PDB:2kn6A	0.072	0.298	2.310E-1	195	0.027	0.169	2kn6A.pdb.gz
15	PDB:7mk2A	0.077	0.229	3.642E-1	354	0.015	0.054	7mk2A.pdb.gz	Structural basis of NPR1 in activating plant immunity.
16	PDB:6sgaFS	0.052	0.190	3.812E-1	277	0.018	0.079	6sgaFS.pdb.gz	Mitoribosomal small subunit biogenesis in trypanosomes involves an extensive assembly machinery.
17	PDB:5juyB	0.066	0.066	4.175E-1	1234	0.019	0.019	5juyB.pdb.gz	A near atomic structure of the active human apoptosome.
18	PDB:3m62A	0.051	0.060	5.242E-1	955	0.052	0.068	3m62A.pdb.gz
19	PDB:3zecB	0.041	0.091	6.889E-1	371	0.036	0.119	3zecB.pdb.gz	Conserved Inhibitory Mechanism and Competent ATP Binding Mode for Adenylyltransferases with Fic Fold.
20	PDB:4irlB	0.064	0.156	6.889E-1	463	0.019	0.052	4irlB.pdb.gz	Structure of the caspase-recruitment domain from a zebrafish guanylate-binding protein.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9NUA8	0.0	2559	1239	1.000	1.000	ZBT40_HUMAN Zinc finger and BTB domain-containing protein 40 OS=Homo sapiens OX=9606 GN=ZBTB40 PE=1 SV=4
2	Q32M78	2.74e-58	215	642	0.114	0.220	ZN699_HUMAN Zinc finger protein 699 OS=Homo sapiens OX=9606 GN=ZNF699 PE=1 SV=1
3	Q96PQ6	2.36e-56	209	595	0.096	0.200	ZN317_HUMAN Zinc finger protein 317 OS=Homo sapiens OX=9606 GN=ZNF317 PE=1 SV=2
4	P17020	3.67e-55	207	682	0.115	0.210	ZNF16_HUMAN Zinc finger protein 16 OS=Homo sapiens OX=9606 GN=ZNF16 PE=1 SV=3
5	A6NNF4	1.57e-54	204	616	0.113	0.227	ZN726_HUMAN Zinc finger protein 726 OS=Homo sapiens OX=9606 GN=ZNF726 PE=1 SV=5
6	Q96NJ6	2.39e-54	200	502	0.107	0.263	ZFP3_HUMAN Zinc finger protein 3 homolog OS=Homo sapiens OX=9606 GN=ZFP3 PE=1 SV=1
7	Q8NEP9	2.76e-54	203	628	0.114	0.225	ZN555_HUMAN Zinc finger protein 555 OS=Homo sapiens OX=9606 GN=ZNF555 PE=1 SV=4
8	Q03923	2.93e-54	202	595	0.114	0.237	ZNF85_HUMAN Zinc finger protein 85 OS=Homo sapiens OX=9606 GN=ZNF85 PE=1 SV=3
9	Q147U1	4.31e-54	200	533	0.096	0.223	ZN846_HUMAN Zinc finger protein 846 OS=Homo sapiens OX=9606 GN=ZNF846 PE=1 SV=2
10	Q49A12	9.63e-54	199	536	0.114	0.263	Q49A12_HUMAN ZNF85 protein OS=Homo sapiens OX=9606 GN=ZNF85 PE=1 SV=1
11	Q86WZ6	7.17e-53	202	799	0.113	0.175	ZN227_HUMAN Zinc finger protein 227 OS=Homo sapiens OX=9606 GN=ZNF227 PE=1 SV=1
12	Q96MU6	1.02e-52	201	729	0.113	0.192	ZN778_HUMAN Zinc finger protein 778 OS=Homo sapiens OX=9606 GN=ZNF778 PE=1 SV=3
13	Q3KP31	1.44e-52	197	576	0.122	0.262	ZN791_HUMAN Zinc finger protein 791 OS=Homo sapiens OX=9606 GN=ZNF791 PE=1 SV=1
14	Q7TMN8	1.04e-51	194	578	0.105	0.225	Q7TMN8_MOUSE Zfp420 protein OS=Mus musculus OX=10090 GN=Zfp420 PE=1 SV=1
15	Q9Y3M9	1.07e-51	197	751	0.118	0.194	ZN337_HUMAN Zinc finger protein 337 OS=Homo sapiens OX=9606 GN=ZNF337 PE=1 SV=2
16	P17141	2.03e-51	194	594	0.098	0.205	ZFP37_MOUSE Zinc finger protein 37 OS=Mus musculus OX=10090 GN=Zfp37 PE=2 SV=4
17	Q8BLA2	2.97e-51	193	578	0.104	0.223	Q8BLA2_MOUSE C2H2-type domain-containing protein OS=Mus musculus OX=10090 GN=Zfp420 PE=2 SV=1
18	P35789	4.36e-51	193	620	0.117	0.234	ZNF93_HUMAN Zinc finger protein 93 OS=Homo sapiens OX=9606 GN=ZNF93 PE=1 SV=4
19	P15620	5.18e-51	192	580	0.123	0.264	ZN271_MOUSE Zinc finger protein 271 OS=Mus musculus OX=10090 GN=Znf271 PE=2 SV=1
20	Q8IYB9	5.28e-51	194	648	0.103	0.198	ZN595_HUMAN Zinc finger protein 595 OS=Homo sapiens OX=9606 GN=ZNF595 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00651 BTB	1.2e-17	75.5	BTB/POZ domain
2	PF09237 GAGA	8.1e+02	11.5	GAGA factor
3	PF18608 XAF1_C	44	15.0	XIAP-associated factor 1 C-terminal domain
4	PF00096 zf-C2H2	7.9e-31	115.9	Zinc finger, C2H2 type
5	PF16622 zf-C2H2_11	1.6e+02	13.5	zinc-finger C2H2-type
6	PF13894 zf-C2H2_4	1.2e-23	92.8	C2H2-type zinc finger
7	PF13912 zf-C2H2_6	9.6e+02	11.2	C2H2-type zinc finger
8	PF15909 zf-C2H2_8	5.2e+02	12.4	C2H2-type zinc ribbon
9	PF12171 zf-C2H2_jaz	0.38	22.3	Zinc-finger double-stranded RNA-binding
10	PF13913 zf-C2HC_2	2.2e+02	13.1	zinc-finger of a C2HC-type
11	PF13465 zf-H2C2_2	3.7e-26	101.6	Zinc-finger double domain
12	PF13909 zf-H2C2_5	18	16.5	C2H2-type zinc-finger domain
13	PF12874 zf-met	0.0023	29.5	Zinc-finger of C2H2 type

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000384527

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000270708	0.814	WD repeat-containing protein WRAP73
2	9606.ENSP00000348982	0.744	Multiple epidermal growth factor-like domains protein 6
3	9606.ENSP00000307746	0.716	Zinc finger protein 608
4	9606.ENSP00000347648	0.648	Zinc finger protein 512
5	9606.ENSP00000359837	0.637	ZZ-type zinc finger-containing protein 3
6	9606.ENSP00000348842	0.613	Echinoderm microtubule-associated protein-like 6
7	9606.ENSP00000009041	0.609	STARD3 N-terminal-like protein
8	9606.ENSP00000385936	0.607	Doublecortin domain-containing protein 5
9	9606.ENSP00000313500	0.602	Uncharacterized protein C17orf53
10	9606.ENSP00000349259	0.566	Spectrin beta chain, non-erythrocytic 1
11	9606.ENSP00000239374	0.564	Coiled-coil domain containing 170
12	9606.ENSP00000323635	0.559	Protein FAM210A
13	9606.ENSP00000025301	0.557	A-kinase anchor protein 11
14	9606.ENSP00000438040	0.556	Coiled-coil domain-containing protein 91
15	9606.ENSP00000326272	0.546	Forkhead box protein L1
16	9606.ENSP00000266604	0.527	Protein LLP homolog
17	9606.ENSP00000346829	0.517	Protein wntless homolog
18	9606.ENSP00000356476	0.507	TRMT1-like protein
19	9606.ENSP00000481021	0.506	Putative protein SEM1, isoform 2
20	9606.ENSP00000294304	0.505	Low-density lipoprotein receptor-related protein 5

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0097159	0.807	organic cyclic compound binding
GO:1901363	0.803	heterocyclic compound binding
GO:0003676	0.770	nucleic acid binding
GO:0003677	0.533	DNA binding
GO:0140110	0.336	transcription regulator activity
GO:0003700	0.334	DNA-binding transcription factor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.989	cellular process
GO:0050794	0.872	regulation of cellular process
GO:0051716	0.847	cellular response to stimulus
GO:0019222	0.560	regulation of metabolic process
GO:0006974	0.554	cellular response to DNA damage stimulus
GO:0080090	0.550	regulation of primary metabolic process
GO:0060255	0.548	regulation of macromolecule metabolic process
GO:0031323	0.545	regulation of cellular metabolic process
GO:0051171	0.534	regulation of nitrogen compound metabolic process
GO:0010468	0.492	regulation of gene expression
GO:0048519	0.385	negative regulation of biological process
GO:0048518	0.369	positive regulation of biological process
GO:0048522	0.358	positive regulation of cellular process
GO:0019219	0.336	regulation of nucleobase-containing compound metabolic process
GO:0048523	0.331	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005737	0.884	cytoplasm
GO:0031981	0.755	nuclear lumen
GO:0005654	0.651	nucleoplasm
GO:0005829	0.372	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]