StarFunc result for job id Q9NUD5

User Input

>input (403 residues)
MATGGGAEEERKRGRPQLLPPARPAARGEEADGGREKMGWAQVVKNLAEKKGEFREPRPP
RREEESGGGGGSAGLGGPAGLAAPDLGDFPPAGRGDPKGRRRDPAGEAVDPRKKKGAAEA
GRRKKAEAAAAAMATPARPGEAEDAAERPLQDEPAAAAGPGKGRFLVRICFQGDEGACPT
RDFVVGALILRSIGMDPSDIYAVIQIPGSREFDVSFRSAEKLALFLRVYEEKREQEDCWE
NFVVLGRSKSSLKTLFILFRNETVDVEDIVTWLKRHCDVLAVPVKVTDRFGIWTGEYKCE
IELRQGEGGVRHLPGAFFLGAERGYSWYKGQPKTCFKCGSRTHMSGSCTQDRCFRCGEEG
HLSPYCRKGIVCNLCGKRGHAFAQCPKAVHNSVAAQLTGVAGH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NUD5	1.000	1.000	1.227E-75	403	1.000	1.000	Q9NUD5.pdb.gz	ZCHC3_HUMAN Zinc finger CCHC domain-containing protein 3 OS=Homo sapiens OX=9606 GN=ZCCHC3 PE=1 SV=2
2	AFDB:P27476	0.149	0.145	4.012E-5	414	0.127	0.123	P27476.pdb.gz	NSR1_YEAST Nuclear localization sequence-binding protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NSR1 PE=1 SV=1
3	AFDB:Q1PEP5	0.176	0.131	6.519E-5	636	0.122	0.077	Q1PEP5.pdb.gz	NUCL2_ARATH Nucleolin 2 OS=Arabidopsis thaliana OX=3702 GN=NUCL2 PE=1 SV=1
4	AFDB:Q5AB84	0.141	0.142	2.477E-4	400	0.094	0.095	Q5AB84.pdb.gz	Q5AB84_CANAL RRM domain-containing protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CAALFM_C100160CA PE=4 SV=1
5	AFDB:Q6SJ96	0.121	0.128	6.948E-4	375	0.112	0.120	Q6SJ96.pdb.gz	TBPL2_HUMAN TATA box-binding protein-like 2 OS=Homo sapiens OX=9606 GN=TBPL2 PE=2 SV=1
6	PDB:6y53o	0.152	0.321	1.361E-3	160	0.047	0.119	6y53o.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
7	PDB:5lsbA	0.155	0.314	1.844E-3	176	0.047	0.108	5lsbA.pdb.gz
8	AFDB:F4KDM9	0.138	0.081	4.037E-3	866	0.104	0.048	F4KDM9.pdb.gz	F4KDM9_ARATH RNA-binding KH domain-containing protein OS=Arabidopsis thaliana OX=3702 GN=HEN4 PE=1 SV=1
9	AFDB:Q584Q1	0.156	0.092	4.037E-3	724	0.156	0.087	Q584Q1.pdb.gz	Q584Q1_TRYB2 RNA-binding protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.4M18.1180 PE=4 SV=1
10	AFDB:Q57TU8	0.159	0.102	5.467E-3	666	0.117	0.071	Q57TU8.pdb.gz	Q57TU8_TRYB2 RNA-binding protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.30K1.520 PE=4 SV=1
11	PDB:7oqcF	0.141	0.203	7.005E-3	267	0.079	0.120	7oqcF.pdb.gz	Structural insights into how Prp5 proofreads the pre-mRNA branch site.
12	AFDB:O13674	0.151	0.098	7.868E-3	654	0.094	0.058	O13674.pdb.gz	MUG24_SCHPO Meiotically up-regulated gene 24 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug24 PE=1 SV=1
13	PDB:2v9kA	0.136	0.123	8.404E-3	467	0.050	0.043	2v9kA.pdb.gz	Crystal Structure of Human Pus10, a Novel Pseudouridine Synthase.
14	AFDB:Q8VE92	0.159	0.177	9.439E-3	357	0.072	0.081	Q8VE92.pdb.gz	RBM4B_MOUSE RNA-binding protein 4B OS=Mus musculus OX=10090 GN=Rbm4b PE=1 SV=1
15	PDB:4al5A	0.153	0.296	1.285E-2	189	0.057	0.122	4al5A.pdb.gz	Csy4 Relies on an Unusual Catalytic Dyad to Position and Cleave Crispr RNA.
16	PDB:2xliA	0.154	0.323	1.451E-2	167	0.045	0.108	2xliA.pdb.gz	Sequence- and Structure-Specific RNA Processing by a Crispr Endonuclease.
17	PDB:3vcdA	0.124	0.229	1.638E-2	184	0.050	0.109	3vcdA.pdb.gz
18	PDB:1jk9B	0.136	0.205	2.219E-2	243	0.055	0.091	1jk9B.pdb.gz	Heterodimeric structure of superoxide dismutase in complex with its metallochaperone.
19	PDB:6aggZ	0.111	0.107	4.595E-2	420	0.065	0.062	6aggZ.pdb.gz	Structure of tRNA-Modifying Enzyme TiaS and Motions of Its Substrate Binding Zinc Ribbon.
20	PDB:6fonA	0.125	0.181	5.188E-2	252	0.030	0.048	6fonA.pdb.gz	Molecular recognition and maturation of SOD1 by its evolutionarily destabilised cognate chaperone hCCS.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8BPK2	0.0	674	400	0.868	0.875	ZCHC3_MOUSE Zinc finger CCHC domain-containing protein 3 OS=Mus musculus OX=10090 GN=Zcchc3 PE=2 SV=1
2	Q9NUD5	0.0	811	403	1.000	1.000	ZCHC3_HUMAN Zinc finger CCHC domain-containing protein 3 OS=Homo sapiens OX=9606 GN=ZCCHC3 PE=1 SV=2
3	P53849	4.49e-05	45.4	153	0.055	0.144	GIS2_YEAST Zinc finger protein GIS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GIS2 PE=1 SV=1
4	Q383X8	6.11e-05	47.4	516	0.050	0.039	Q383X8_TRYB2 Nucleic acid binding protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.1270 PE=4 SV=1
5	Q8GXC5	1.78e-04	45.1	257	0.057	0.089	Q8GXC5_ARATH DNA-binding protein OS=Arabidopsis thaliana OX=3702 GN=At1g75560 PE=1 SV=1
6	P40507	2.43e-04	45.4	360	0.055	0.061	AIR1_YEAST Protein AIR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=AIR1 PE=1 SV=1
7	P53996	2.93e-04	43.5	178	0.052	0.118	CNBP_MOUSE CCHC-type zinc finger nucleic acid binding protein OS=Mus musculus OX=10090 GN=Cnbp PE=1 SV=2
8	P62633	3.18e-04	43.5	177	0.052	0.119	CNBP_HUMAN CCHC-type zinc finger nucleic acid binding protein OS=Homo sapiens OX=9606 GN=CNBP PE=1 SV=1
9	P62634	3.18e-04	43.5	177	0.052	0.119	CNBP_RAT CCHC-type zinc finger nucleic acid binding protein OS=Rattus norvegicus OX=10116 GN=Cnbp PE=2 SV=1
10	Q9HFF2	3.28e-04	43.9	218	0.069	0.128	YL92_SCHPO Uncharacterized protein C683.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC683.02c PE=4 SV=1
11	E7FCQ0	5.09e-04	42.7	161	0.052	0.130	E7FCQ0_DANRE CCHC-type zinc finger, nucleic acid-binding protein b OS=Danio rerio OX=7955 GN=cnbp PE=1 SV=2
12	Q960D5	6.82e-04	44.3	1358	0.062	0.018	Q960D5_DROME SD06557p OS=Drosophila melanogaster OX=7227 GN=Zcchc7 PE=2 SV=1
13	Q9VVA9	8.19e-04	44.3	1734	0.062	0.014	Q9VVA9_DROME Zinc finger CCHC-type containing 7 OS=Drosophila melanogaster OX=7227 GN=Zcchc7 PE=4 SV=2
14	Q12476	0.001	42.7	344	0.050	0.058	AIR2_YEAST Protein AIR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=AIR2 PE=1 SV=1
15	F1Q6Z5	0.004	40.0	163	0.052	0.129	F1Q6Z5_DANRE CCHC-type zinc finger, nucleic acid-binding protein a OS=Danio rerio OX=7955 GN=fe36b09 PE=1 SV=1
16	J9VH01	0.006	41.2	1641	0.052	0.013	J9VH01_CRYNH CCHC-type domain-containing protein OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) OX=235443 GN=CNAG_00520 PE=1 SV=1
17	Q586R7	0.009	40.4	441	0.037	0.034	Q586R7_TRYB2 RNA-binding protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=30M24.225 PE=4 SV=1
18	P69730	0.010	40.4	486	0.057	0.047	GAG_EIAV9 Gag polyprotein OS=Equine infectious anemia virus (isolate 1369) OX=11670 GN=gag PE=1 SV=1
19	Q8N567	0.010	39.7	271	0.062	0.092	ZCHC9_HUMAN Zinc finger CCHC domain-containing protein 9 OS=Homo sapiens OX=9606 GN=ZCCHC9 PE=1 SV=2
20	Q8T8R1	0.016	38.5	165	0.062	0.152	CNBP_DROME CCHC-type zinc finger nucleic acid binding protein OS=Drosophila melanogaster OX=7227 GN=CNBP PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00098 zf-CCHC	0.012	26.8	Zinc knuckle
2	PF13696 zf-CCHC_2	1.8e+02	13.4	Zinc knuckle
3	PF14392 zf-CCHC_4	2.5e+02	12.7	Zinc knuckle

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000484056

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000476792	0.783	Retrotransposon Gag-like protein 5
2	9606.ENSP00000316794	0.767	Retrotransposon Gag-like protein 3
3	9606.ENSP00000302768	0.763	Polyadenylate-binding protein-interacting protein 1
4	9606.ENSP00000008391	0.760	Transcription factor AP-2-delta
5	9606.ENSP00000419786	0.743	Retrotransposon Gag-like protein 9
6	9606.ENSP00000280191	0.712	Spermatogenesis-associated protein 4
7	9606.ENSP00000399797	0.628	Putative helicase MOV-10
8	9606.ENSP00000340590	0.603	Retrotransposon Gag-like protein 4
9	9606.ENSP00000374390	0.580	Probable G-protein coupled receptor 149
10	9606.ENSP00000360268	0.579	Delta-1-pyrroline-5-carboxylate synthase
11	9606.ENSP00000285518	0.571	1-acyl-sn-glycerol-3-phosphate acyltransferase epsilon
12	9606.ENSP00000402000	0.570	Septin-4
13	9606.ENSP00000323889	0.560	E3 ubiquitin/ISG15 ligase TRIM25
14	9606.ENSP00000357113	0.559	Gamma-interferon-inducible protein 16
15	9606.ENSP00000305161	0.546	E3 ubiquitin-protein ligase TRIM56
16	9606.ENSP00000313007	0.539	Polyadenylate-binding protein 1
17	9606.ENSP00000360905	0.536	Cytosolic carboxypeptidase 6
18	9606.ENSP00000341247	0.525	Eukaryotic peptide chain release factor GTP-binding subunit ERF3B
19	9606.ENSP00000375582	0.514	Zinc finger protein 552
20	9606.ENSP00000416951	0.510	Zinc finger CCCH-type containing 18

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding
GO:0003690	1.000	double-stranded DNA binding
GO:0003824	0.408	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.997	regulation of biological process
GO:0009987	0.988	cellular process
GO:0050896	0.985	response to stimulus
GO:0050794	0.983	regulation of cellular process
GO:0045089	0.979	positive regulation of innate immune response
GO:1901698	0.976	response to nitrogen compound
GO:0044419	0.974	biological process involved in interspecies interaction between organisms
GO:0009607	0.974	response to biotic stimulus
GO:0009605	0.971	response to external stimulus
GO:0043331	0.968	response to dsRNA
GO:0048522	0.963	positive regulation of cellular process
GO:0043330	0.944	response to exogenous dsRNA
GO:0009615	0.939	response to virus
GO:0051716	0.926	cellular response to stimulus
GO:0071407	0.924	cellular response to organic cyclic compound
GO:0002253	0.907	activation of immune response
GO:1901699	0.901	cellular response to nitrogen compound
GO:0002218	0.901	activation of innate immune response
GO:0023051	0.892	regulation of signaling
GO:0010646	0.889	regulation of cell communication
GO:0019222	0.855	regulation of metabolic process
GO:0060255	0.842	regulation of macromolecule metabolic process
GO:0010468	0.804	regulation of gene expression
GO:0009966	0.794	regulation of signal transduction
GO:0062207	0.749	regulation of pattern recognition receptor signaling pathway
GO:0010647	0.734	positive regulation of cell communication
GO:0009967	0.723	positive regulation of signal transduction
GO:0062208	0.671	positive regulation of pattern recognition receptor signaling pathway
GO:0010604	0.459	positive regulation of macromolecule metabolic process
GO:0071359	0.357	cellular response to dsRNA
GO:0039531	0.343	regulation of viral-induced cytoplasmic pattern recognition receptor signaling pathway
GO:0051171	0.334	regulation of nitrogen compound metabolic process
GO:0031323	0.305	regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005829	0.956	cytosol
GO:0043226	0.950	organelle
GO:0043229	0.943	intracellular organelle
GO:0043232	0.922	intracellular non-membrane-bounded organelle
GO:0005634	0.872	nucleus
GO:0031974	0.539	membrane-enclosed lumen
GO:0070013	0.528	intracellular organelle lumen
GO:0031981	0.306	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]