StarFunc result for job id Q9NUI1

User Input

>input (292 residues)
MAQPPPDVEGDDCLPAYRHLFCPDLLRDKVAFITGGGSGIGFRIAEIFMRHGCHTVIASR
SLPRVLTAARKLAGATGRRCLPLSMDVRAPPAVMAAVDQALKEFGRIDILINCAAGNFLC
PAGALSFNAFKTVMDIDTSGTFNVSRVLYEKFFRDHGGVIVNITATLGNRGQALQVHAGS
AKAAVDAMTRHLAVEWGPQNIRVNSLAPGPISGTEGLRRLGGPQASLSTKVTASPLQRLG
NKTEIAHSVLYLASPLASYVTGAVLVADGGAWLTFPNGVKGLPDFASFSAKL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NUI1	1.000	1.000	2.941E-64	292	1.000	1.000	Q9NUI1.pdb.gz	DECR2_HUMAN Peroxisomal 2,4-dienoyl-CoA reductase [(3E)-enoyl-CoA-producing] OS=Homo sapiens OX=9606 GN=DECR2 PE=1 SV=1
2	PDB:4fc6B	0.944	0.999	7.412E-58	276	0.945	1.000	4fc6B.pdb.gz	Studies of human 2,4-dienoyl CoA reductase shed new light on peroxisomal beta-oxidation of unsaturated fatty acids
3	AFDB:Q9Z2M4	0.945	0.945	3.512E-52	292	0.808	0.808	Q9Z2M4.pdb.gz	DECR2_RAT Peroxisomal 2,4-dienoyl-CoA reductase [(3E)-enoyl-CoA-producing] OS=Rattus norvegicus OX=10116 GN=Decr2 PE=1 SV=1
4	AFDB:P32573	0.861	0.861	3.929E-31	292	0.387	0.387	P32573.pdb.gz	SPS19_YEAST Peroxisomal 2,4-dienoyl-CoA reductase SPS19 [(3E)-enoyl-CoA-producing] OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SPS19 PE=1 SV=4
5	AFDB:Q9LTV6	0.857	0.840	4.177E-31	298	0.401	0.393	Q9LTV6.pdb.gz	DECR2_ARATH Peroxisomal 2,4-dienoyl-CoA reductase [(3E)-enoyl-CoA-producing] OS=Arabidopsis thaliana OX=3702 GN=At3g12800 PE=2 SV=1
6	AFDB:Q9BY49	0.840	0.810	8.181E-31	303	0.315	0.304	Q9BY49.pdb.gz	PECR_HUMAN Peroxisomal trans-2-enoyl-CoA reductase OS=Homo sapiens OX=9606 GN=PECR PE=1 SV=2
7	AFDB:Q9WVK3	0.833	0.803	8.871E-30	303	0.288	0.277	Q9WVK3.pdb.gz	PECR_RAT Peroxisomal trans-2-enoyl-CoA reductase OS=Rattus norvegicus OX=10116 GN=Pecr PE=2 SV=1
8	AFDB:Q9JIF5	0.816	0.790	1.361E-29	302	0.291	0.281	Q9JIF5.pdb.gz	PECR_CAVPO Peroxisomal trans-2-enoyl-CoA reductase OS=Cavia porcellus OX=10141 GN=PECR PE=1 SV=1
9	PDB:1yxmA	0.829	0.815	2.287E-28	297	0.325	0.320	1yxmA.pdb.gz	Crystal structure of perixomal trans 2-enoyl CoA reductase (PECRA)
10	AFDB:Q99MZ7	0.805	0.776	3.923E-28	303	0.281	0.271	Q99MZ7.pdb.gz	PECR_MOUSE Peroxisomal trans-2-enoyl-CoA reductase OS=Mus musculus OX=10090 GN=Pecr PE=1 SV=1
11	AFDB:Q93761	0.833	0.778	7.229E-28	313	0.329	0.307	Q93761.pdb.gz	YXEK_CAEEL Uncharacterized oxidoreductase F53C11.3 OS=Caenorhabditis elegans OX=6239 GN=F53C11.3 PE=3 SV=1
12	AFDB:Q64591	0.846	0.740	8.169E-28	335	0.301	0.263	Q64591.pdb.gz	DECR_RAT 2,4-dienoyl-CoA reductase [(3E)-enoyl-CoA-producing], mitochondrial OS=Rattus norvegicus OX=10116 GN=Decr1 PE=1 SV=2
13	PDB:1w6uA	0.824	0.835	1.583E-25	288	0.308	0.312	1w6uA.pdb.gz	Structure and Reactivity of Human Mitochondrial 2,4-Dienoyl-Coa Reductase: Enzyme-Ligand Interactions in a Distinctive Short-Chain Reductase Active Site
14	PDB:1yxmC	0.735	0.811	4.474E-25	264	0.281	0.311	1yxmC.pdb.gz	Crystal structure of perixomal trans 2-enoyl CoA reductase (PECRA)
15	PDB:4is3C	0.790	0.918	1.940E-24	250	0.295	0.344	4is3C.pdb.gz	Crystal structure of a 3alpha-hydroxysteroid dehydrogenase (BaiA2) associated with secondary bile acid synthesis from Clostridium scindens VPI12708 in complex with a putative NAD(+)-OH- adduct at 2.0 A resolution
16	PDB:6emmA	0.784	0.850	1.549E-23	268	0.260	0.284	6emmA.pdb.gz	X-ray Crystallographic Fragment screening and Hit Optimization
17	PDB:2c07A	0.777	0.914	1.751E-23	246	0.223	0.264	2c07A.pdb.gz
18	PDB:3ay6B	0.789	0.860	3.035E-23	267	0.281	0.307	3ay6B.pdb.gz	Structure-guided mutagenesis for the improvement of substrate speciﬁcity of Bacillus megaterium glucose 1-dehydrogenase IV
19	PDB:4cqlI	0.796	0.923	3.646E-23	251	0.223	0.259	4cqlI.pdb.gz	Insights Into Mitochondrial Fatty Acid Synthesis from the Structure of Heterotetrameric 3-Ketoacyl-Acp Reductase/3R-Hydroxyacyl-Coa Dehydrogenase.
20	PDB:4cqmF	0.767	0.923	5.261E-23	241	0.243	0.295	4cqmF.pdb.gz	Insights Into Mitochondrial Fatty Acid Synthesis from the Structure of Heterotetrameric 3-Ketoacyl-Acp Reductase/3R-Hydroxyacyl-Coa Dehydrogenase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9NUI1	0.0	594	292	1.000	1.000	DECR2_HUMAN Peroxisomal 2,4-dienoyl-CoA reductase [(3E)-enoyl-CoA-producing] OS=Homo sapiens OX=9606 GN=DECR2 PE=1 SV=1
2	Q9Z2M4	1.30e-173	483	292	0.832	0.832	DECR2_RAT Peroxisomal 2,4-dienoyl-CoA reductase [(3E)-enoyl-CoA-producing] OS=Rattus norvegicus OX=10116 GN=Decr2 PE=1 SV=1
3	A0A8I6AJE6	9.73e-148	417	292	0.757	0.757	A0A8I6AJE6_RAT Peroxisomal 2,4-dienoyl-CoA reductase [(3E)-enoyl-CoA-producing] OS=Rattus norvegicus OX=10116 GN=Nme4 PE=1 SV=1
4	A0A8I6GLQ6	4.13e-138	392	275	0.688	0.731	A0A8I6GLQ6_RAT Peroxisomal 2,4-dienoyl-CoA reductase [(3E)-enoyl-CoA-producing] OS=Rattus norvegicus OX=10116 GN=Nme4 PE=1 SV=1
5	P32573	4.50e-58	189	292	0.366	0.366	SPS19_YEAST Peroxisomal 2,4-dienoyl-CoA reductase SPS19 [(3E)-enoyl-CoA-producing] OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SPS19 PE=1 SV=4
6	Q9LTV6	8.38e-50	168	298	0.387	0.379	DECR2_ARATH Peroxisomal 2,4-dienoyl-CoA reductase [(3E)-enoyl-CoA-producing] OS=Arabidopsis thaliana OX=3702 GN=At3g12800 PE=2 SV=1
7	Q9BY49	7.69e-46	158	303	0.308	0.297	PECR_HUMAN Peroxisomal trans-2-enoyl-CoA reductase OS=Homo sapiens OX=9606 GN=PECR PE=1 SV=2
8	Q6TXF6	3.83e-44	162	867	0.271	0.091	Q6TXF6_RAT LRRGT00043 OS=Rattus norvegicus OX=10116 GN=Decr2 PE=1 SV=1
9	Q9WVK3	4.75e-43	151	303	0.284	0.274	PECR_RAT Peroxisomal trans-2-enoyl-CoA reductase OS=Rattus norvegicus OX=10116 GN=Pecr PE=2 SV=1
10	Q9CQ62	5.06e-42	149	335	0.301	0.263	DECR_MOUSE 2,4-dienoyl-CoA reductase [(3E)-enoyl-CoA-producing], mitochondrial OS=Mus musculus OX=10090 GN=Decr1 PE=1 SV=1
11	Q64591	1.13e-41	148	335	0.301	0.263	DECR_RAT 2,4-dienoyl-CoA reductase [(3E)-enoyl-CoA-producing], mitochondrial OS=Rattus norvegicus OX=10116 GN=Decr1 PE=1 SV=2
12	Q16698	1.91e-37	137	335	0.315	0.275	DECR_HUMAN 2,4-dienoyl-CoA reductase [(3E)-enoyl-CoA-producing], mitochondrial OS=Homo sapiens OX=9606 GN=DECR1 PE=1 SV=1
13	Q9JIF5	9.55e-35	129	302	0.298	0.288	PECR_CAVPO Peroxisomal trans-2-enoyl-CoA reductase OS=Cavia porcellus OX=10141 GN=PECR PE=1 SV=1
14	Q99MZ7	1.70e-34	129	303	0.281	0.271	PECR_MOUSE Peroxisomal trans-2-enoyl-CoA reductase OS=Mus musculus OX=10090 GN=Pecr PE=1 SV=1
15	Q93761	4.01e-34	128	313	0.329	0.307	YXEK_CAEEL Uncharacterized oxidoreductase F53C11.3 OS=Caenorhabditis elegans OX=6239 GN=F53C11.3 PE=3 SV=1
16	P37440	8.20e-32	120	263	0.312	0.346	UCPA_ECOLI Oxidoreductase UcpA OS=Escherichia coli (strain K12) OX=83333 GN=ucpA PE=1 SV=3
17	P39485	6.55e-31	118	261	0.271	0.303	DHG4_PRIMG Glucose 1-dehydrogenase 4 OS=Priestia megaterium OX=1404 GN=gdhIV PE=1 SV=1
18	P19337	1.29e-30	117	249	0.288	0.337	BAIA2_CLOSV 3alpha-hydroxy bile acid-CoA-ester 3-dehydrogenase 2 OS=Clostridium scindens (strain JCM 10418 / VPI 12708) OX=29347 GN=baiA2 PE=1 SV=1
19	P9WGQ5	5.70e-30	115	263	0.325	0.361	Y927C_MYCTU Uncharacterized oxidoreductase Rv0927c OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv0927c PE=1 SV=1
20	P07914	6.72e-30	115	249	0.281	0.329	BAIA1_CLOSV 3alpha-hydroxy bile acid-CoA-ester 3-dehydrogenase 1/3 OS=Clostridium scindens (strain JCM 10418 / VPI 12708) OX=29347 GN=baiA1 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00106 adh_short	6.3e-40	148.2	short chain dehydrogenase
2	PF13561 adh_short_C2	6.8e-49	178.1	Enoyl-(Acyl carrier protein) reductase
3	PF08659 KR	1.8e-05	36.3	KR domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000219481

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000369461	0.980	Enoyl-CoA delta isomerase 2, mitochondrial
2	9606.ENSP00000420914	0.976	Peroxisomal multifunctional enzyme type 2
3	9606.ENSP00000221418	0.967	Delta(3,5)-Delta(2,4)-dienoyl-CoA isomerase, mitochondrial
4	9606.ENSP00000315013	0.961	Carnitine O-acetyltransferase
5	9606.ENSP00000293217	0.958	Peroxisomal acyl-coenzyme A oxidase 1
6	9606.ENSP00000307697	0.956	Peroxisomal acyl-coenzyme A oxidase 2
7	9606.ENSP00000231887	0.955	Peroxisomal bifunctional enzyme
8	9606.ENSP00000217455	0.953	Acyl-coenzyme A thioesterase 8
9	9606.ENSP00000323811	0.952	2-hydroxyacyl-CoA lyase 1
10	9606.ENSP00000241052	0.949	Catalase
11	9606.ENSP00000348775	0.947	Peroxisomal acyl-coenzyme A oxidase 3
12	9606.ENSP00000363614	0.936	Hydroxymethylglutaryl-CoA lyase, mitochondrial
13	9606.ENSP00000262430	0.933	Malonyl-CoA decarboxylase, mitochondrial
14	9606.ENSP00000323071	0.932	Acyl-coenzyme A thioesterase 4
15	9606.ENSP00000371517	0.931	Alpha-methylacyl-CoA racemase
16	9606.ENSP00000431049	0.931	Soluble glutathione S-transferases
17	9606.ENSP00000267842	0.929	Very long-chain acyl-CoA synthetase
18	9606.ENSP00000413575	0.927	Peroxisomal carnitine O-octanoyltransferase
19	9606.ENSP00000302620	0.925	Alanine-glyoxylate aminotransferase
20	9606.ENSP00000238651	0.923	Acyl-coenzyme A thioesterase 2, mitochondrial

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016628	1.000	oxidoreductase activity, acting on the CH-CH group of donors, NAD or NADP as acceptor
GO:0016616	0.999	oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
GO:0005515	0.995	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.989	organic substance metabolic process
GO:0044238	0.988	primary metabolic process
GO:0044237	0.988	cellular metabolic process
GO:0009062	0.950	fatty acid catabolic process
GO:0019395	0.948	fatty acid oxidation
GO:0009058	0.935	biosynthetic process
GO:0006635	0.899	fatty acid beta-oxidation
GO:1901576	0.877	organic substance biosynthetic process
GO:0033559	0.780	unsaturated fatty acid metabolic process
GO:0044249	0.771	cellular biosynthetic process
GO:0072330	0.758	monocarboxylic acid biosynthetic process
GO:0008610	0.675	lipid biosynthetic process
GO:0006636	0.632	unsaturated fatty acid biosynthetic process
GO:0065007	0.325	biological regulation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005777	0.999	peroxisome
GO:0098588	0.996	bounding membrane of organelle
GO:0005829	0.994	cytosol
GO:0031903	0.961	microbody membrane
GO:0070013	0.941	intracellular organelle lumen
GO:0005778	0.939	peroxisomal membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.3.1.-	1.000	With NAD(+) or NADP(+) as acceptor.
EC:1.1.1.-	0.999	With NAD(+) or NADP(+) as acceptor.

[back to server]