StarFunc result for job id Q9NUL5

User Input

>input (291 residues)
MSQEGVELEKSVRRLREKFHGKVSSKKAGALMRKFGSDHTGVGRSIVYGVKQKDGQELSN
DLDAQDPPEDMKQDRDIQAVATSLLPLTEANLRMFQRAQDDLIPAVDRQFACSSCDHVWW
RRVPQRKEVSRCRKCRKRYEPVPADKMWGLAEFHCPKCRHNFRGWAQMGSPSPCYGCGFP
VYPTRILPPRWDRDPDRRSTHTHSCSAADCYNRREPHVPGTSCAHPKSRKQNHLPKVLHP
SNPHISSGSTVATCLSQGGLLEDLDNLILEDLKEEEEEEEEVEDEEGGPRE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NUL5	1.000	1.000	2.797E-54	291	1.000	1.000	Q9NUL5.pdb.gz	SHFL_HUMAN Shiftless antiviral inhibitor of ribosomal frameshifting protein OS=Homo sapiens OX=9606 GN=SHFL PE=1 SV=2
2	AFDB:O65426	0.117	0.201	1.486E-2	155	0.055	0.103	O65426.pdb.gz	LOL2_ARATH Protein LOL2 OS=Arabidopsis thaliana OX=3702 GN=LOL2 PE=1 SV=1
3	AFDB:P94077	0.100	0.148	1.570E-2	189	0.065	0.101	P94077.pdb.gz	LSD1_ARATH Protein LSD1 OS=Arabidopsis thaliana OX=3702 GN=LSD1 PE=1 SV=1
4	AFDB:F8RP38	0.137	0.200	1.850E-2	176	0.082	0.136	F8RP38.pdb.gz	F8RP38_PEA Histone demethylase SWIRM1 OS=Pisum sativum OX=3888 GN=KIW84_071581 PE=1 SV=1
5	AFDB:Q93ZB1	0.112	0.196	3.567E-2	154	0.048	0.091	Q93ZB1.pdb.gz	LOL1_ARATH Protein LOL1 OS=Arabidopsis thaliana OX=3702 GN=LOL1 PE=2 SV=1
6	AFDB:F4JUW0	0.156	0.202	5.527E-2	210	0.100	0.138	F4JUW0.pdb.gz	F4JUW0_ARATH LSD1 zinc finger family protein OS=Arabidopsis thaliana OX=3702 GN=LSD1 PE=1 SV=1
7	AFDB:O64867	0.127	0.197	1.189E-1	180	0.041	0.067	O64867.pdb.gz	O64867_ARATH At2g44330 OS=Arabidopsis thaliana OX=3702 GN=BTL14 PE=2 SV=1
8	AFDB:Q583D9	0.127	0.265	1.564E-1	121	0.062	0.149	Q583D9.pdb.gz	Q583D9_TRYB2 Zinc finger LSD1-type domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.3I12.630 PE=4 SV=1
9	AFDB:Q0J7V9	0.107	0.164	2.056E-1	184	0.045	0.071	Q0J7V9.pdb.gz	LSD1_ORYSJ Protein LSD1 OS=Oryza sativa subsp. japonica OX=39947 GN=LSD1 PE=2 SV=1
10	PDB:6wgg6	0.129	0.071	4.141E-1	576	0.079	0.040	6wgg6.pdb.gz	Structural mechanism of helicase loading onto replication origin DNA by ORC-Cdc6.
11	AFDB:F1R8E2	0.089	0.036	4.673E-1	1475	0.110	0.022	F1R8E2.pdb.gz	F1R8E2_DANRE Protein patched homolog 1 OS=Danio rerio OX=7955 GN=lep PE=3 SV=2
12	PDB:6edtJ	0.104	0.254	6.074E-1	109	0.055	0.147	6edtJ.pdb.gz	Structures of an RNA polymerase promoter melting intermediate elucidate DNA unwinding.
13	PDB:6wgf4	0.114	0.060	6.416E-1	636	0.055	0.025	6wgf4.pdb.gz
14	PDB:7mzvA	0.091	0.066	7.158E-1	583	0.062	0.031	7mzvA.pdb.gz
15	PDB:1cqxA	0.106	0.084	1.109	403	0.079	0.057	1cqxA.pdb.gz	Crystal structure of the flavohemoglobin from Alcaligenes eutrophus at 1.75 A resolution.
16	PDB:7tysA	0.065	0.067	1.109	361	0.038	0.030	7tysA.pdb.gz	Ligand-mediated Structural Dynamics of a Mammalian Pancreatic K ATP Channel.
17	PDB:1gvhA	0.084	0.072	1.307	396	0.069	0.051	1gvhA.pdb.gz	The X-Ray Structure of Ferric Escherichia Coli Flavohemoglobin Reveals an Unexpected Geometry of the Distal Heme Pocket
18	PDB:4mqwB	0.063	0.149	1.458	109	0.024	0.064	4mqwB.pdb.gz
19	PDB:7ajuCE	0.185	0.134	1.627	436	0.052	0.034	7ajuCE.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
20	PDB:7d58L	0.098	0.393	2.025	47	0.027	0.170	7d58L.pdb.gz	Structural insights into transcriptional regulation of human RNA polymerase III.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9NUL5	0.0	604	291	1.000	1.000	SHFL_HUMAN Shiftless antiviral inhibitor of ribosomal frameshifting protein OS=Homo sapiens OX=9606 GN=SHFL PE=1 SV=2
2	Q1LVF0	0.027	38.5	1593	0.079	0.014	LAMC1_DANRE Laminin subunit gamma-1 OS=Danio rerio OX=7955 GN=lamc1 PE=2 SV=2
3	Q5XM24	0.16	35.8	494	0.048	0.028	APRA_DICDI Autocrine proliferation repressor protein A OS=Dictyostelium discoideum OX=44689 GN=aprA PE=1 SV=1
4	Q84JL5	0.29	35.0	633	0.134	0.062	INVH_ARATH Probable alkaline/neutral invertase A, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=INVH PE=2 SV=1
5	A0A494C0M1	0.55	34.3	1261	0.062	0.014	A0A494C0M1_HUMAN DNA mismatch repair protein OS=Homo sapiens OX=9606 GN=MSH6 PE=1 SV=1
6	E7EZF3	0.56	34.3	776	0.079	0.030	UHRF1_DANRE E3 ubiquitin-protein ligase UHRF1 OS=Danio rerio OX=7955 GN=uhrf1 PE=1 SV=1
7	P27958	0.60	34.3	3011	0.103	0.010	POLG_HCV77 Genome polyprotein OS=Hepatitis C virus genotype 1a (isolate H77) OX=63746 PE=1 SV=3
8	P26664	0.64	34.3	3011	0.103	0.010	POLG_HCV1 Genome polyprotein OS=Hepatitis C virus genotype 1a (isolate 1) OX=11104 PE=1 SV=3
9	P52701	0.67	34.3	1360	0.062	0.013	MSH6_HUMAN DNA mismatch repair protein Msh6 OS=Homo sapiens OX=9606 GN=MSH6 PE=1 SV=2
10	Q03463	0.93	33.9	3011	0.103	0.010	POLG_HCVJ1 Genome polyprotein OS=Hepatitis C virus genotype 1b (isolate HC-J1) OX=421877 PE=1 SV=1
11	O92972	1.1	33.5	3010	0.096	0.009	POLG_HCVJ4 Genome polyprotein OS=Hepatitis C virus genotype 1b (strain HC-J4) OX=420174 PE=1 SV=2
12	O93077	1.7	32.7	3010	0.096	0.009	O93077_9HEPC Genome polyprotein OS=Hepacivirus hominis OX=3052230 PE=1 SV=1
13	Q913V3	1.7	32.7	3010	0.117	0.011	POLG_HCVR6 Genome polyprotein OS=Hepatitis C virus genotype 1b (isolate HCR6) OX=421879 PE=1 SV=1
14	Q9WMX2	2.0	32.7	3010	0.117	0.011	POLG_HCVCO Genome polyprotein OS=Hepatitis C virus genotype 1b (isolate Con1) OX=333284 PE=1 SV=3
15	P29846	3.5	32.0	3010	0.086	0.008	POLG_HCVTW Genome polyprotein OS=Hepatitis C virus genotype 1b (isolate Taiwan) OX=31645 PE=1 SV=3
16	Q7KV18	4.1	30.8	171	0.055	0.094	Q7KV18_DROME Ste:CG33242 OS=Drosophila melanogaster OX=7227 GN=Ste:CG33242 PE=3 SV=2
17	P98160	5.1	31.6	4391	0.058	0.004	PGBM_HUMAN Basement membrane-specific heparan sulfate proteoglycan core protein OS=Homo sapiens OX=9606 GN=HSPG2 PE=1 SV=4
18	A0A8I6A2S5	5.2	31.2	4402	0.058	0.004	A0A8I6A2S5_RAT Heparan sulfate proteoglycan 2 OS=Rattus norvegicus OX=10116 GN=Hspg2 PE=1 SV=1
19	A0A8I6ASH2	5.2	31.2	4387	0.058	0.004	A0A8I6ASH2_RAT Heparan sulfate proteoglycan 2 OS=Rattus norvegicus OX=10116 GN=Hspg2 PE=1 SV=1
20	Q05793	5.6	31.2	3707	0.058	0.005	PGBM_MOUSE Basement membrane-specific heparan sulfate proteoglycan core protein OS=Mus musculus OX=10090 GN=Hspg2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF15135 UPF0515	4e-117	402.0	Uncharacterised protein UPF0515
2	PF17180 zf-3CxxC_2	92	15.1	Zinc-binding domain
3	PF13465 zf-H2C2_2	1.7e+02	14.1	Zinc-finger double domain
4	PF13717 zinc_ribbon_4	18	16.6	zinc-ribbon domain
5	PF09723 Zn-ribbon_8	26	16.4	Zinc ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010372091.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010358843.1	0.550	La ribonucleoprotein domain family member 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0043022	1.000	ribosome binding
GO:1990825	1.000	sequence-specific mRNA binding
GO:0042802	0.999	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0006955	0.990	immune response
GO:0051607	0.988	defense response to virus
GO:0034097	0.987	response to cytokine
GO:0045071	0.987	negative regulation of viral genome replication
GO:0010556	0.981	regulation of macromolecule biosynthetic process
GO:0031326	0.981	regulation of cellular biosynthetic process
GO:0045087	0.981	innate immune response
GO:0034340	0.971	response to type I interferon
GO:0006417	0.970	regulation of translation
GO:0010629	0.968	negative regulation of gene expression
GO:0048523	0.961	negative regulation of cellular process
GO:0051248	0.942	negative regulation of protein metabolic process
GO:0035456	0.917	response to interferon-beta
GO:0031324	0.917	negative regulation of cellular metabolic process
GO:0009890	0.888	negative regulation of biosynthetic process
GO:0010558	0.868	negative regulation of macromolecule biosynthetic process
GO:0016032	0.865	viral process
GO:0031327	0.809	negative regulation of cellular biosynthetic process
GO:0006448	0.803	regulation of translational elongation
GO:0009987	0.746	cellular process
GO:2000113	0.706	negative regulation of cellular macromolecule biosynthetic process
GO:0017148	0.514	negative regulation of translation
GO:0051128	0.411	regulation of cellular component organization
GO:0034341	0.384	response to type II interferon
GO:0048518	0.382	positive regulation of biological process
GO:0043244	0.367	regulation of protein-containing complex disassembly

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	0.999	nucleoplasm
GO:0036464	0.998	cytoplasmic ribonucleoprotein granule
GO:0000932	0.994	P-body

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]