StarFunc result for job id Q9NUQ9

User Input

>input (324 residues)
MGNLLKVLTCTDLEQGPNFFLDFENAQPTESEKEIYNQVNVVLKDAEGILEDLQSYRGAG
HEIREAIQHPADEKLQEKAWGAVVPLVGKLKKFYEFSQRLEAALRGLLGALTSTPYSPTQ
HLEREQALAKQFAEILHFTLRFDELKMTNPAIQNDFSYYRRTLSRMRINNVPAEGENEVN
NELANRMSLFYAEATPMLKTLSDATTKFVSENKNLPIENTTDCLSTMASVCRVMLETPEY
RSRFTNEETVSFCLRVMVGVIILYDHVHPVGAFAKTSKIDMKGCIKVLKDQPPNSVEGLL
NALRYTTKHLNDETTSKQIKSMLQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q921M7	0.986	0.986	4.221E-41	324	0.997	0.997	Q921M7.pdb.gz	CYRIB_MOUSE CYFIP-related Rac1 interactor B OS=Mus musculus OX=10090 GN=Cyrib PE=1 SV=1
2	AFDB:A0A0R4IMR9	0.949	0.809	7.477E-34	381	0.750	0.638	A0A0R4IMR9.pdb.gz	A0A0R4IMR9_DANRE Family with sequence similarity 49 member A OS=Danio rerio OX=7955 GN=fam49ab PE=1 SV=1
3	PDB:7ajlAAA	0.824	0.915	6.728E-31	290	0.892	0.997	7ajlAAA.pdb.gz
4	AFDB:Q7K1H0	0.941	0.941	4.630E-27	324	0.543	0.543	Q7K1H0.pdb.gz	Q7K1H0_DROME GH09096p OS=Drosophila melanogaster OX=7227 GN=CG6491 PE=1 SV=1
5	AFDB:Q09387	0.878	0.853	1.371E-18	334	0.349	0.338	Q09387.pdb.gz	Q09387_CAEEL CYRIA/CYRIB Rac1 binding domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=CELE_R07G3.8 PE=1 SV=1
6	AFDB:Q9VF87	0.600	0.167	2.175E-5	1291	0.191	0.048	Q9VF87.pdb.gz	CYFIP_DROME Cytoplasmic FMR1-interacting protein OS=Drosophila melanogaster OX=7227 GN=Cyfip PE=1 SV=1
7	PDB:7usdA	0.595	0.180	2.346E-5	1185	0.170	0.046	7usdA.pdb.gz	Structures reveal a key mechanism of WAVE regulatory complex activation by Rac1 GTPase.
8	AFDB:D4A8H8	0.575	0.167	2.683E-5	1253	0.176	0.045	D4A8H8.pdb.gz	D4A8H8_RAT Cytoplasmic FMR1-interacting protein OS=Rattus norvegicus OX=10116 GN=Cyfip1 PE=3 SV=1
9	AFDB:Q5S2C3	0.627	0.179	1.219E-4	1282	0.179	0.045	Q5S2C3.pdb.gz	PIR_ARATH Protein PIR OS=Arabidopsis thaliana OX=3702 GN=PIR PE=1 SV=2
10	PDB:3zhpA	0.150	0.153	1.725E-2	315	0.127	0.130	3zhpA.pdb.gz
11	PDB:3gniA	0.129	0.127	2.315E-2	335	0.130	0.125	3gniA.pdb.gz	ATP and MO25alpha regulate the conformational state of the STRADalpha pseudokinase and activation of the LKB1 tumour suppressor
12	AFDB:E7F4L4	0.557	0.186	2.648E-2	1173	0.130	0.036	E7F4L4.pdb.gz	E7F4L4_DANRE WASH complex subunit 4 OS=Danio rerio OX=7955 GN=si:dkey-23p11.2 PE=1 SV=1
13	PDB:3axjB	0.183	0.233	4.731E-2	240	0.099	0.133	3axjB.pdb.gz
14	AFDB:Q9W517	0.138	0.050	4.975E-2	1741	0.139	0.026	Q9W517.pdb.gz	WAPL_DROME Protein wings apart-like OS=Drosophila melanogaster OX=7227 GN=wapl PE=1 SV=1
15	PDB:2z6gA	0.137	0.092	5.367E-2	550	0.114	0.067	2z6gA.pdb.gz
16	PDB:7bfpC	0.162	0.173	5.838E-2	298	0.105	0.114	7bfpC.pdb.gz
17	PDB:3msvA	0.210	0.198	7.203E-2	352	0.111	0.102	3msvA.pdb.gz
18	PDB:7sx3E	0.180	0.048	8.172E-2	1611	0.173	0.035	7sx3E.pdb.gz	Structural architecture of the human NALCN channelosome.
19	AFDB:V6CLA2	0.101	0.028	8.239E-2	2648	0.154	0.019	V6CLA2.pdb.gz	HECD1_CAEEL E3 ubiquitin-protein ligase hecd-1 OS=Caenorhabditis elegans OX=6239 GN=hecd-1 PE=1 SV=1
20	PDB:6v9iC	0.133	0.071	9.270E-2	730	0.148	0.066	6v9iC.pdb.gz	Structure and dynamics of the ASB9 CUL-RING E3 Ligase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0R4IMR9	0.0	509	381	0.750	0.638	A0A0R4IMR9_DANRE Family with sequence similarity 49 member A OS=Danio rerio OX=7955 GN=fam49ab PE=1 SV=1
2	Q7ZW35	0.0	511	323	0.750	0.752	Q7ZW35_DANRE Family with sequence similarity 49 member A OS=Danio rerio OX=7955 GN=znf395 PE=1 SV=1
3	Q921M7	0.0	675	324	0.997	0.997	CYRIB_MOUSE CYFIP-related Rac1 interactor B OS=Mus musculus OX=10090 GN=Cyrib PE=1 SV=1
4	Q9NUQ9	0.0	676	324	1.000	1.000	CYRIB_HUMAN CYFIP-related Rac1 interactor B OS=Homo sapiens OX=9606 GN=CYRIB PE=1 SV=1
5	Q7K1H0	7.70e-120	349	324	0.552	0.552	Q7K1H0_DROME GH09096p OS=Drosophila melanogaster OX=7227 GN=CG6491 PE=1 SV=1
6	Q09387	8.23e-64	207	334	0.349	0.338	Q09387_CAEEL CYRIA/CYRIB Rac1 binding domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=CELE_R07G3.8 PE=1 SV=1
7	Q9VF87	8.04e-04	43.5	1291	0.154	0.039	CYFIP_DROME Cytoplasmic FMR1-interacting protein OS=Drosophila melanogaster OX=7227 GN=Cyfip PE=1 SV=1
8	P34036	0.24	35.8	4730	0.102	0.007	DYHC_DICDI Dynein heavy chain, cytoplasmic OS=Dictyostelium discoideum OX=44689 GN=dhcA PE=1 SV=2
9	A0A1D8PDK6	0.59	33.5	206	0.105	0.165	A0A1D8PDK6_CANAL 6,7-dimethyl-8-ribityllumazine synthase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=RIB4 PE=3 SV=1
10	Q91ZU6	4.7	31.6	7393	0.046	0.002	DYST_MOUSE Dystonin OS=Mus musculus OX=10090 GN=Dst PE=1 SV=2
11	P31412	5.5	31.2	392	0.077	0.064	VATC_YEAST V-type proton ATPase subunit C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=VMA5 PE=1 SV=4
12	Q5S2C3	5.6	31.6	1282	0.037	0.009	PIR_ARATH Protein PIR OS=Arabidopsis thaliana OX=3702 GN=PIR PE=1 SV=2
13	Q8IRQ5	7.3	30.8	467	0.080	0.056	Q8IRQ5_DROME fumarate hydratase OS=Drosophila melanogaster OX=7227 GN=Fum1 PE=1 SV=1
14	Q9SRH9	8.4	30.8	1372	0.062	0.015	SNL1_ARATH Paired amphipathic helix protein Sin3-like 1 OS=Arabidopsis thaliana OX=3702 GN=SNL1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07159 CYRIA-B_Rac1-bd	2.3e-145	495.1	CYRIA/CYRIB Rac1 binding domain
2	PF19443 DAHL	1.4e+02	13.6	DAHL domain
3	PF03224 V-ATPase_H_N	19	16.0	V-ATPase subunit H

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 132908.ENSPVAP00000010523

Rank	PPI partner	STRING score	Description
1	132908.ENSPVAP00000013938	0.641	Angiopoietin-like 7
2	132908.ENSPVAP00000011231	0.592	Leucine rich repeat containing 40
3	132908.ENSPVAP00000014384	0.521	Tubulointerstitial nephritis antigen
4	132908.ENSPVAP00000005575	0.516	Ankyrin repeat and sterile alpha motif domain containing 1B
5	132908.ENSPVAP00000014710	0.516	Ankyrin repeat and sterile alpha motif domain containing 1A
6	132908.ENSPVAP00000000455	0.513	Testis expressed 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0044877	0.983	protein-containing complex binding
GO:0042287	0.974	MHC protein binding
GO:0023023	0.973	MHC protein complex binding
GO:0023030	0.879	MHC class Ib protein binding, via antigen binding groove

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.975	biological regulation
GO:0009987	0.975	cellular process
GO:0050794	0.974	regulation of cellular process
GO:0010821	0.912	regulation of mitochondrion organization
GO:0048583	0.887	regulation of response to stimulus
GO:0043254	0.867	regulation of protein-containing complex assembly
GO:0090140	0.840	regulation of mitochondrial fission
GO:0051056	0.791	regulation of small GTPase mediated signal transduction
GO:0060255	0.790	regulation of macromolecule metabolic process
GO:0048519	0.783	negative regulation of biological process
GO:0050896	0.756	response to stimulus
GO:0071840	0.747	cellular component organization or biogenesis
GO:0016043	0.740	cellular component organization
GO:0065008	0.731	regulation of biological quality
GO:0048518	0.727	positive regulation of biological process
GO:0010468	0.701	regulation of gene expression
GO:0032878	0.697	regulation of establishment or maintenance of cell polarity
GO:0048522	0.687	positive regulation of cellular process
GO:0048523	0.682	negative regulation of cellular process
GO:0051493	0.680	regulation of cytoskeleton organization
GO:0071219	0.669	cellular response to molecule of bacterial origin
GO:0051058	0.668	negative regulation of small GTPase mediated signal transduction
GO:0032970	0.638	regulation of actin filament-based process
GO:0032271	0.614	regulation of protein polymerization
GO:0051129	0.549	negative regulation of cellular component organization
GO:0032956	0.522	regulation of actin cytoskeleton organization
GO:1902903	0.521	regulation of supramolecular fiber organization
GO:0009893	0.501	positive regulation of metabolic process
GO:0050865	0.492	regulation of cell activation
GO:0110053	0.478	regulation of actin filament organization
GO:0030832	0.450	regulation of actin filament length
GO:0032501	0.426	multicellular organismal process
GO:2000114	0.424	regulation of establishment of cell polarity
GO:0002682	0.415	regulation of immune system process
GO:0031341	0.404	regulation of cell killing
GO:0008152	0.389	metabolic process
GO:0048856	0.386	anatomical structure development
GO:0050776	0.380	regulation of immune response
GO:0010604	0.373	positive regulation of macromolecule metabolic process
GO:0002694	0.370	regulation of leukocyte activation
GO:0002697	0.369	regulation of immune effector process
GO:0002703	0.361	regulation of leukocyte mediated immunity
GO:0002684	0.356	positive regulation of immune system process
GO:0002819	0.353	regulation of adaptive immune response
GO:0007275	0.350	multicellular organism development
GO:0050863	0.340	regulation of T cell activation
GO:0048731	0.336	system development
GO:0048584	0.320	positive regulation of response to stimulus
GO:0071704	0.313	organic substance metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0070013	0.999	intracellular organelle lumen
GO:0005737	0.993	cytoplasm
GO:0005576	0.987	extracellular region
GO:0012505	0.959	endomembrane system
GO:0031982	0.912	vesicle
GO:0005615	0.910	extracellular space
GO:0005634	0.874	nucleus
GO:0070062	0.873	extracellular exosome
GO:0031981	0.828	nuclear lumen
GO:0005654	0.731	nucleoplasm
GO:0042995	0.714	cell projection
GO:0120025	0.701	plasma membrane bounded cell projection
GO:0005739	0.601	mitochondrion
GO:0016020	0.569	membrane
GO:0031410	0.410	cytoplasmic vesicle
GO:0005929	0.387	cilium
GO:0099503	0.307	secretory vesicle
GO:0032991	0.306	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]