StarFunc result for job id Q9NUT2

User Input

>input (735 residues)
MLVHLFRVGIRGGPFPGRLLPPLRFQTFSAVRNTWRNGKTGQLHKAEGEYSDGYRSSSLL
RAVAHLRSQLWAHLPRAPLAPRWSPSAWCWVGGALLGPMVLSKHPHLCLVALCEAEEAPP
ASSTPHVVGSRFNWKLFWQFLHPHLLVLGVAVVLALGAALVNVQIPLLLGQLVEVVAKYT
RDHVGSFMTESQNLSTHLLILYGVQGLLTFGYLVLLSHVGERMAVDMRRALFSSLLRQDI
TFFDANKTGQLVSRLTTDVQEFKSSFKLVISQGLRSCTQVAGCLVSLSMLSTRLTLLLMV
ATPALMGVGTLMGSGLRKLSRQCQEQIARAMGVADEALGNVRTVRAFAMEQREEERYGAE
LEACRCRAEELGRGIALFQGLSNIAFNCMVLGTLFIGGSLVAGQQLTGGDLMSFLVASQT
VQRSMANLSVLFGQVVRGLSAGARVFEYMALNPCIPLSGGCCVPKEQLRGSVTFQNVCFS
YPCRPGFEVLKDFTLTLPPGKIVALVGQSGGGKTTVASLLERFYDPTAGVVMLDGRDLRT
LDPSWLRGQVVGFISQEPVLFGTTIMENIRFGKLEASDEEVYTAAREANAHEFITSFPEG
YNTVVGERGTTLSGGQKQRLAIARALIKQPTVLILDEATSALDAESERVVQEALDRASAG
RTVLVIAHRLSTVRGAHCIVVMADGRVWEAGTHEELLKKGGLYAELIRRQALDAPRTAAP
PPKKPEGPRSHQHKS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NUT2	1.000	1.000	0.000	735	1.000	1.000	Q9NUT2.pdb.gz	MITOS_HUMAN Mitochondrial potassium channel ATP-binding subunit OS=Homo sapiens OX=9606 GN=ABCB8 PE=1 SV=3
2	AFDB:Q9CXJ4	0.850	0.871	1.016E-90	717	0.823	0.844	Q9CXJ4.pdb.gz	MITOS_MOUSE Mitochondrial potassium channel ATP-binding subunit OS=Mus musculus OX=10090 GN=Abcb8 PE=1 SV=1
3	PDB:7ehlA	0.655	0.842	1.965E-64	563	0.762	0.995	7ehlA.pdb.gz	Cryo-EM structure of human ABCB8 transporter in nucleotide binding state.
4	AFDB:Q9BL17	0.794	0.872	2.505E-60	668	0.426	0.469	Q9BL17.pdb.gz	Q9BL17_CAEEL ATP-binding cassette sub-family B member 8, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=haf-6 PE=1 SV=3
5	AFDB:F1Q5K6	0.768	0.795	4.433E-51	710	0.328	0.339	F1Q5K6.pdb.gz	F1Q5K6_DANRE ATP-binding cassette sub-family B member 10, mitochondrial OS=Danio rerio OX=7955 GN=abcb10 PE=1 SV=1
6	AFDB:Q9NRK6	0.768	0.765	6.765E-50	738	0.344	0.343	Q9NRK6.pdb.gz	ABCBA_HUMAN ATP-binding cassette sub-family B member 10, mitochondrial OS=Homo sapiens OX=9606 GN=ABCB10 PE=1 SV=2
7	AFDB:Q9JI39	0.768	0.789	7.134E-49	715	0.350	0.359	Q9JI39.pdb.gz	ABCBA_MOUSE ATP-binding cassette sub-family B member 10, mitochondrial OS=Mus musculus OX=10090 GN=Abcb10 PE=1 SV=1
8	AFDB:Q54BU4	0.761	0.617	1.362E-48	909	0.302	0.244	Q54BU4.pdb.gz	ABCB1_DICDI ABC transporter B family member 1 OS=Dictyostelium discoideum OX=44689 GN=abcB1 PE=3 SV=1
9	AFDB:Q0WML0	0.772	0.879	3.276E-48	644	0.329	0.376	Q0WML0.pdb.gz	AB27B_ARATH ABC transporter B family member 27 OS=Arabidopsis thaliana OX=3702 GN=ABCB27 PE=1 SV=1
10	AFDB:Q6P2Q0	0.768	0.735	1.202E-46	769	0.302	0.289	Q6P2Q0.pdb.gz	Q6P2Q0_HUMAN ABCB9 protein OS=Homo sapiens OX=9606 GN=ABCB9 PE=2 SV=1
11	AFDB:Q9FNU2	0.768	0.878	2.192E-46	641	0.332	0.381	Q9FNU2.pdb.gz	AB25B_ORYSJ ABC transporter B family member 25 OS=Oryza sativa subsp. japonica OX=39947 GN=ABCB25 PE=2 SV=1
12	PDB:7ph3A	0.645	0.800	8.527E-39	577	0.246	0.314	7ph3A.pdb.gz	The ABC transporter MsbA adopts the wide inward-open conformation in E. coli cells.
13	PDB:5mkkA	0.673	0.821	2.706E-38	593	0.276	0.342	5mkkA.pdb.gz
14	PDB:5mkkB	0.705	0.886	1.033E-37	577	0.252	0.321	5mkkB.pdb.gz
15	PDB:4q4aA	0.714	0.904	5.975E-37	572	0.237	0.304	4q4aA.pdb.gz	Structural basis for allosteric cross-talk between the asymmetric nucleotide binding sites of a heterodimeric ABC exporter.
16	PDB:4m1mA	0.684	0.433	1.505E-36	1188	0.264	0.163	4m1mA.pdb.gz	Refined structures of mouse P-glycoprotein.
17	PDB:3qf4B	0.715	0.883	1.986E-36	588	0.241	0.301	3qf4B.pdb.gz	Crystal structure of a heterodimeric ABC transporter in its inward-facing conformation
18	PDB:6qexA	0.679	0.434	5.524E-35	1182	0.283	0.176	6qexA.pdb.gz	Structural insight into substrate and inhibitor discrimination by human P-glycoprotein.
19	PDB:4f4cA	0.626	0.383	5.786E-35	1250	0.259	0.152	4f4cA.pdb.gz	Crystal structure of the multidrug transporter P-glycoprotein from Caenorhabditis elegans.
20	PDB:5u1dA	0.629	0.802	2.042E-32	561	0.248	0.324	5u1dA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	C9JTY4	0.0	804	431	0.551	0.940	C9JTY4_HUMAN ATP binding cassette subfamily B member 8 OS=Homo sapiens OX=9606 GN=ABCB8 PE=1 SV=1
2	C9JYI3	0.0	808	409	0.552	0.993	C9JYI3_HUMAN ATP binding cassette subfamily B member 8 OS=Homo sapiens OX=9606 GN=ABCB8 PE=1 SV=1
3	Q9BL17	0.0	607	668	0.403	0.443	Q9BL17_CAEEL ATP-binding cassette sub-family B member 8, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=haf-6 PE=1 SV=3
4	Q9CXJ4	0.0	1206	717	0.824	0.845	MITOS_MOUSE Mitochondrial potassium channel ATP-binding subunit OS=Mus musculus OX=10090 GN=Abcb8 PE=1 SV=1
5	Q9NUT2	0.0	1494	735	1.000	1.000	MITOS_HUMAN Mitochondrial potassium channel ATP-binding subunit OS=Homo sapiens OX=9606 GN=ABCB8 PE=1 SV=3
6	Q54W24	4.72e-151	460	767	0.325	0.312	ABCB4_DICDI ABC transporter B family member 4 OS=Dictyostelium discoideum OX=44689 GN=abcB4 PE=3 SV=1
7	Q9JI39	6.20e-142	435	715	0.337	0.347	ABCBA_MOUSE ATP-binding cassette sub-family B member 10, mitochondrial OS=Mus musculus OX=10090 GN=Abcb10 PE=1 SV=1
8	Q9NRK6	8.59e-141	432	738	0.316	0.314	ABCBA_HUMAN ATP-binding cassette sub-family B member 10, mitochondrial OS=Homo sapiens OX=9606 GN=ABCB10 PE=1 SV=2
9	Q54BU4	2.05e-136	426	909	0.309	0.250	ABCB1_DICDI ABC transporter B family member 1 OS=Dictyostelium discoideum OX=44689 GN=abcB1 PE=3 SV=1
10	Q9FNU2	2.83e-130	402	641	0.325	0.373	AB25B_ORYSJ ABC transporter B family member 25 OS=Oryza sativa subsp. japonica OX=39947 GN=ABCB25 PE=2 SV=1
11	F1Q5K6	1.02e-125	392	710	0.313	0.324	F1Q5K6_DANRE ATP-binding cassette sub-family B member 10, mitochondrial OS=Danio rerio OX=7955 GN=abcb10 PE=1 SV=1
12	Q0WML0	4.97e-119	373	644	0.302	0.345	AB27B_ARATH ABC transporter B family member 27 OS=Arabidopsis thaliana OX=3702 GN=ABCB27 PE=1 SV=1
13	Q9NP78	1.11e-117	373	766	0.301	0.289	ABCB9_HUMAN ABC-type oligopeptide transporter ABCB9 OS=Homo sapiens OX=9606 GN=ABCB9 PE=1 SV=1
14	Q9QYJ4	4.41e-116	369	762	0.280	0.270	ABCB9_RAT ABC-type oligopeptide transporter ABCB9 OS=Rattus norvegicus OX=10116 GN=Abcb9 PE=1 SV=1
15	Q6P2Q0	7.95e-116	369	769	0.301	0.287	Q6P2Q0_HUMAN ABCB9 protein OS=Homo sapiens OX=9606 GN=ABCB9 PE=2 SV=1
16	Q801W2	1.20e-115	367	725	0.309	0.313	Q801W2_DANRE ATP-binding cassette, sub-family B (MDR\/TAP), member 3 OS=Danio rerio OX=7955 GN=TAP2 PE=4 SV=1
17	O44897	2.66e-114	366	815	0.314	0.283	O44897_CAEEL ABC-type antigen peptide transporter OS=Caenorhabditis elegans OX=6239 GN=haf-9 PE=1 SV=2
18	Q9FHF1	2.13e-112	370	1248	0.290	0.171	AB7B_ARATH ABC transporter B family member 7 OS=Arabidopsis thaliana OX=3702 GN=ABCB7 PE=3 SV=1
19	Q9TZD9	2.75e-112	360	787	0.271	0.253	Q9TZD9_CAEEL ABC-type antigen peptide transporter OS=Caenorhabditis elegans OX=6239 GN=haf-4 PE=1 SV=2
20	Q8T9W4	5.84e-111	369	1432	0.302	0.155	ABCB3_DICDI ABC transporter B family member 3 OS=Dictyostelium discoideum OX=44689 GN=abcB3 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00004 AAA	1.3e+02	14.4	ATPase family associated with various cellular activities (AAA)
2	PF13191 AAA_16	0.32	22.8	AAA ATPase domain
3	PF13401 AAA_22	2.4	19.9	AAA domain
4	PF13481 AAA_25	76	14.3	AAA domain
5	PF13604 AAA_30	39	15.4	AAA domain
6	PF09818 ABC_ATPase	12	16.4	ATPase of the ABC class
7	PF00664 ABC_membrane	3.2e-49	179.6	ABC transporter transmembrane region
8	PF06472 ABC_membrane_2	47	14.8	ABC transporter transmembrane region 2
9	PF00005 ABC_tran	2.9e-28	110.6	ABC transporter
10	PF01583 APS_kinase	81	14.6	Adenylylsulphate kinase
11	PF01935 DUF87	77	14.8	Helicase HerA, central domain
12	PF06168 DUF981	1.8e+02	13.4	Protein of unknown function (DUF981)
13	PF18748 Ploopntkinase1	5.2e+02	11.5	P-loop Nucleotide Kinase1
14	PF13558 SbcC_Walker_B	51	15.6	SbcC/RAD50-like, Walker B motif
15	PF02463 SMC_N	0.033	25.2	RecF/RecN/SMC N terminal domain
16	PF06414 Zeta_toxin	0.11	23.4	Zeta toxin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000297504

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000344155	0.810	ATP-binding cassette sub-family A member 2
2	9606.ENSP00000265316	0.808	ATP-binding cassette sub-family B member 6, mitochondrial
3	9606.ENSP00000272286	0.792	ATP-binding cassette sub-family G member 8
4	9606.ENSP00000260645	0.790	ATP-binding cassette sub-family G member 5
5	9606.ENSP00000349396	0.788	ATP-binding cassette sub-family D member 4
6	9606.ENSP00000250111	0.757	Sodium/potassium-transporting ATPase subunit beta-2
7	9606.ENSP00000253577	0.753	ATP-binding cassette sub-family B member 7, mitochondrial
8	9606.ENSP00000440045	0.746	Sarcoplasmic/endoplasmic reticulum calcium ATPase 2
9	9606.ENSP00000445306	0.746	Sodium/potassium-transporting ATPase subunit alpha-1
10	9606.ENSP00000218548	0.745	Potassium-transporting ATPase alpha chain 2
11	9606.ENSP00000444688	0.738	Sodium/potassium-transporting ATPase subunit alpha-3
12	9606.ENSP00000354490	0.737	Sodium/potassium-transporting ATPase subunit alpha-2
13	9606.ENSP00000263980	0.732	Sodium/hydrogen exchanger 1
14	9606.ENSP00000286371	0.726	Sodium/potassium-transporting ATPase subunit beta-3
15	9606.ENSP00000356790	0.726	Sodium/potassium-transporting ATPase subunit beta-1
16	9606.ENSP00000350132	0.720	Cardiac phospholamban
17	9606.ENSP00000481244	0.720	Phospholemman
18	9606.ENSP00000355637	0.667	ATP-binding cassette sub-family B member 10, mitochondrial
19	9606.ENSP00000359526	0.634	Mitoferrin-2
20	9606.ENSP00000222388	0.616	ATP binding cassette subfamily F member 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0022857	1.000	transmembrane transporter activity
GO:0005515	1.000	protein binding
GO:0005524	1.000	ATP binding
GO:0042626	0.993	ATPase-coupled transmembrane transporter activity
GO:0042802	0.649	identical protein binding
GO:0003824	0.553	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0065007	0.976	biological regulation
GO:0051179	0.925	localization
GO:0051234	0.923	establishment of localization
GO:0006810	0.912	transport
GO:0042592	0.892	homeostatic process
GO:0050789	0.824	regulation of biological process
GO:0055085	0.816	transmembrane transport
GO:0071840	0.806	cellular component organization or biogenesis
GO:0016043	0.720	cellular component organization
GO:0006811	0.702	monoatomic ion transport
GO:0065008	0.686	regulation of biological quality
GO:0098655	0.639	monoatomic cation transmembrane transport
GO:0098662	0.636	inorganic cation transmembrane transport
GO:0030001	0.541	metal ion transport
GO:1990542	0.521	mitochondrial transmembrane transport
GO:0019725	0.516	cellular homeostasis
GO:0050794	0.479	regulation of cellular process
GO:0006813	0.435	potassium ion transport
GO:0008152	0.428	metabolic process
GO:0050896	0.413	response to stimulus
GO:0071704	0.360	organic substance metabolic process
GO:0048878	0.316	chemical homeostasis
GO:0006807	0.313	nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.999	membrane
GO:0005739	0.998	mitochondrion
GO:0032991	0.990	protein-containing complex
GO:1902495	0.981	transmembrane transporter complex
GO:0005886	0.968	plasma membrane
GO:0098533	0.931	ATPase dependent transmembrane transport complex
GO:0034703	0.926	cation channel complex
GO:0098797	0.925	plasma membrane protein complex
GO:0034705	0.923	potassium channel complex
GO:0070013	0.913	intracellular organelle lumen
GO:0031090	0.860	organelle membrane
GO:0005634	0.697	nucleus
GO:0012505	0.466	endomembrane system
GO:0031981	0.465	nuclear lumen
GO:0043190	0.464	ATP-binding cassette (ABC) transporter complex
GO:0005740	0.357	mitochondrial envelope
GO:0031966	0.311	mitochondrial membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:7.-.-.-	0.993	Translocases.

[back to server]