StarFunc result for job id Q9NUU6

User Input

>input (356 residues)
MAATRSPTRARERERSGAPAAGSDQVHSWMLATSQALDTVWRMAKGFVMLAVSFLVAAIC
YFRRLHLYSGHKLKWWIGYLQRKFKRNLSVEAEVDLLSYCAREWKGETPRNKLMRKAYEE
LFWRHHIKCVRQVRRDNYDALRSVLFQIFSQGISFPSWMKEKDIVKLPEKLLFSQGCNWI
QQYSFGPEKYTGSNVFGKLRKYVELLKTQWTEFNGIRDYHKRGSMCNTLFSDAILEYKLY
EALKFIMLYQVTEVYEQMKTKKVIPSLFRLLFSRETSSDPLSFMMNHLNSVGDTCGLEQI
DMFILGYSLEVKIKVFRLFKFNSRDFEVCYPEEPLRDWPEISLLTENDRHYHIPVF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NUU6	1.000	1.000	1.172E-60	356	1.000	1.000	Q9NUU6.pdb.gz	OTULL_HUMAN Inactive ubiquitin thioesterase OTULINL OS=Homo sapiens OX=9606 GN=OTULINL PE=1 SV=1
2	AFDB:Q3UCV8	0.724	0.732	2.466E-26	352	0.312	0.315	Q3UCV8.pdb.gz	OTUL_MOUSE Ubiquitin thioesterase otulin OS=Mus musculus OX=10090 GN=Otulin PE=1 SV=1
3	PDB:4fjvA	0.474	0.703	2.037E-7	231	0.098	0.152	4fjvA.pdb.gz	The human otubain2-ubiquitin structure provides insights into the cleavage specificity of poly-ubiquitin-linkages.
4	PDB:4ddgA	0.524	0.473	3.635E-7	399	0.124	0.110	4ddgA.pdb.gz
5	PDB:4dhjA	0.460	0.638	1.588E-6	248	0.087	0.125	4dhjA.pdb.gz
6	PDB:7n3mAAA	0.123	0.104	1.118E-1	437	0.110	0.089	7n3mAAA.pdb.gz	Discovery of Novel 3-Piperidinyl Pyridine Derivatives as Highly Potent and Selective Cholesterol 24-Hydroxylase (CH24H) Inhibitors.
7	PDB:5zlfA	0.118	0.137	1.179E-1	293	0.059	0.072	5zlfA.pdb.gz	Discovery of Lipophilic Bisphosphonates That Target Bacterial Cell Wall and Quinone Biosynthesis.
8	AFDB:A0A0H3MD02	0.217	0.255	2.560E-1	273	0.110	0.143	A0A0H3MD02.pdb.gz	INCA_CHLT2 Inclusion membrane protein A OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) OX=471472 GN=incA PE=1 SV=2
9	PDB:3aqbD	0.105	0.112	9.188E-1	325	0.065	0.071	3aqbD.pdb.gz	Crystal structure of heterodimeric hexaprenyl diphosphate synthase from Micrococcus luteus B-P 26 reveals that the small subunit is directly involved in the product chain length regulation.
10	PDB:5l25A	0.111	0.104	1.021	399	0.073	0.065	5l25A.pdb.gz
11	PDB:6bwjB	0.117	0.082	1.076	617	0.090	0.052	6bwjB.pdb.gz	Conformational plasticity in the selectivity filter of the TRPV2 ion channel.
12	AFDB:Q6IVC2	0.157	0.119	1.310	472	0.107	0.081	Q6IVC2.pdb.gz	TGAL1_ORYSJ Transcription factor TGAL1 OS=Oryza sativa subsp. japonica OX=39947 GN=TGAL1 PE=1 SV=2
13	PDB:3n0tA	0.121	0.102	1.476	452	0.065	0.051	3n0tA.pdb.gz	Human dipeptidyl peptidase DPP7
14	PDB:7p9uB	0.128	0.109	1.476	455	0.087	0.068	7p9uB.pdb.gz	Molecular basis for redox control by the human cystine/glutamate antiporter system xc .
15	AFDB:D3Z881	0.141	0.067	1.534	1245	0.135	0.039	D3Z881.pdb.gz	D3Z881_RAT TBC1 domain family, member 4 OS=Rattus norvegicus OX=10116 GN=Tbc1d4 PE=1 SV=4
16	AFDB:Q9SQK1	0.137	0.146	1.617	325	0.118	0.129	Q9SQK1.pdb.gz	Q9SQK1_TOBAC BZIP transcription factor OS=Nicotiana tabacum OX=4097 GN=TGA2.2 PE=1 SV=1
17	AFDB:Q39163	0.154	0.166	2.103	330	0.115	0.124	Q39163.pdb.gz	TGA5_ARATH Transcription factor TGA5 OS=Arabidopsis thaliana OX=3702 GN=TGA5 PE=1 SV=2
18	AFDB:Q21339	0.131	0.098	2.217	566	0.124	0.078	Q21339.pdb.gz	NAD3_CAEEL Sodium-dependent high-affinity dicarboxylate transporter 3 OS=Caenorhabditis elegans OX=6239 GN=nac-3 PE=2 SV=3
19	AFDB:Q52MZ2	0.092	0.071	2.597	506	0.112	0.079	Q52MZ2.pdb.gz	TGA10_TOBAC bZIP transcription factor TGA10 OS=Nicotiana tabacum OX=4097 GN=TGA10 PE=1 SV=1
20	AFDB:Q9Z8L4	0.111	0.099	3.041	399	0.118	0.105	Q9Z8L4.pdb.gz	Q9Z8L4_CHLPN Low calcium response E OS=Chlamydia pneumoniae OX=83558 GN=lcrE PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9NUU6	0.0	744	356	1.000	1.000	OTULL_HUMAN Inactive ubiquitin thioesterase OTULINL OS=Homo sapiens OX=9606 GN=OTULINL PE=1 SV=1
2	Q96BN8	5.72e-74	234	352	0.315	0.318	OTUL_HUMAN Ubiquitin thioesterase otulin OS=Homo sapiens OX=9606 GN=OTULIN PE=1 SV=3
3	Q3UCV8	9.63e-73	231	352	0.309	0.312	OTUL_MOUSE Ubiquitin thioesterase otulin OS=Mus musculus OX=10090 GN=Otulin PE=1 SV=1
4	Q584F2	3.1	32.0	320	0.051	0.056	Q584F2_TRYB2 G-actin binding protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.1H19.700 PE=3 SV=1
5	Q55DR6	5.3	31.6	667	0.048	0.025	FCSA_DICDI Fatty acyl-CoA synthetase A OS=Dictyostelium discoideum OX=44689 GN=fcsA PE=1 SV=1
6	A0A8I5Y6H2	7.6	31.2	2046	0.065	0.011	A0A8I5Y6H2_RAT Rho GTPase activating protein 32 OS=Rattus norvegicus OX=10116 GN=Arhgap32 PE=3 SV=1
7	A7KAX9	7.7	31.2	2087	0.065	0.011	RHG32_HUMAN Rho GTPase-activating protein 32 OS=Homo sapiens OX=9606 GN=ARHGAP32 PE=1 SV=1
8	A0A8I6GIC6	7.8	31.2	2061	0.065	0.011	A0A8I6GIC6_RAT Rho GTPase activating protein 32 OS=Rattus norvegicus OX=10116 GN=Arhgap32 PE=3 SV=1
9	F1MAK3	7.9	31.2	2101	0.065	0.011	F1MAK3_RAT Rho GTPase activating protein 32 OS=Rattus norvegicus OX=10116 GN=Arhgap32 PE=1 SV=2
10	Q811P8	7.9	31.2	2089	0.067	0.011	RHG32_MOUSE Rho GTPase-activating protein 32 OS=Mus musculus OX=10090 GN=Arhgap32 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16218 Peptidase_C101	2e-107	370.0	Peptidase family C101

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000274217

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000482732	0.642	Tyrosine-protein phosphatase non-receptor type 9
2	9606.ENSP00000323304	0.641	Leucine rich single-pass membrane protein 1
3	9606.ENSP00000444810	0.627	Peptidyl-prolyl cis-trans isomerase FKBP5
4	9606.ENSP00000333181	0.625	E3 ubiquitin-protein ligase MARCH11
5	9606.ENSP00000363999	0.614	Mitochondrial ribosomal protein L50
6	9606.ENSP00000333779	0.610	Protein EVI2B
7	9606.ENSP00000418086	0.610	Uncharacterized protein C3orf14
8	9606.ENSP00000370057	0.602	FERM and PDZ domain-containing protein 4
9	9606.ENSP00000356438	0.546	Prostaglandin G/H synthase 2
10	9606.ENSP00000335384	0.508	Zona pellucida-binding protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003824	0.586	catalytic activity
GO:0140096	0.491	catalytic activity, acting on a protein

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0008152	0.990	metabolic process
GO:0050789	0.985	regulation of biological process
GO:0071704	0.980	organic substance metabolic process
GO:0070647	0.960	protein modification by small protein conjugation or removal
GO:0050794	0.959	regulation of cellular process
GO:0048583	0.956	regulation of response to stimulus
GO:0070646	0.954	protein modification by small protein removal
GO:0016579	0.941	protein deubiquitination
GO:0048519	0.868	negative regulation of biological process
GO:0009987	0.856	cellular process
GO:0023051	0.835	regulation of signaling
GO:0009966	0.821	regulation of signal transduction
GO:0019222	0.771	regulation of metabolic process
GO:0060255	0.755	regulation of macromolecule metabolic process
GO:0051171	0.501	regulation of nitrogen compound metabolic process
GO:0080090	0.491	regulation of primary metabolic process
GO:0048518	0.427	positive regulation of biological process
GO:0031323	0.414	regulation of cellular metabolic process
GO:0080134	0.411	regulation of response to stress
GO:0048585	0.387	negative regulation of response to stimulus
GO:0019219	0.352	regulation of nucleobase-containing compound metabolic process
GO:0065009	0.348	regulation of molecular function
GO:0050896	0.346	response to stimulus
GO:0010468	0.335	regulation of gene expression
GO:0051252	0.330	regulation of RNA metabolic process
GO:0010556	0.327	regulation of macromolecule biosynthetic process
GO:0031326	0.327	regulation of cellular biosynthetic process
GO:0006355	0.321	regulation of DNA-templated transcription

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0005634	0.998	nucleus
GO:0012505	0.996	endomembrane system
GO:0031090	0.996	organelle membrane
GO:0031975	0.986	envelope
GO:0031967	0.976	organelle envelope
GO:0005783	0.971	endoplasmic reticulum
GO:0031984	0.967	organelle subcompartment
GO:0098554	0.955	cytoplasmic side of endoplasmic reticulum membrane
GO:0005635	0.951	nuclear envelope

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]