StarFunc result for job id Q9NUX5

User Input

>input (634 residues)
MSLVPATNYIYTPLNQLKGGTIVNVYGVVKFFKPPYLSKGTDYCSVVTIVDQTNVKLTCL
LFSGNYEALPIIYKNGDIVRFHRLKIQVYKKETQGITSSGFASLTFEGTLGAPIIPRTSS
KYFNFTTEDHKMVEALRVWASTHMSPSWTLLKLCDVQPMQYFDLTCQLLGKAEVDGASFL
LKVWDGTRTPFPSWRVLIQDLVLEGDLSHIHRLQNLTIDILVYDNHVHVARSLKVGSFLR
IYSLHTKLQSMNSENQTMLSLEFHLHGGTSYGRGIRVLPESNSDVDQLKKDLESANLTAN
QHSDVICQSEPDDSFPSSGSVSLYEVERCQQLSATILTDHQYLERTPLCAILKQKAPQQY
RIRAKLRSYKPRRLFQSVKLHCPKCHLLQEVPHEGDLDIIFQDGATKTPDVKLQNTSLYD
SKIWTTKNQKGRKVAVHFVKNNGILPLSNECLLLIEGGTLSEICKLSNKFNSVIPVRSGH
EDLELLDLSAPFLIQGTIHHYGCKQCSSLRSIQNLNSLVDKTSWIPSSVAEALGIVPLQY
VFVMTFTLDDGTGVLEAYLMDSDKFFQIPASEVLMDDDLQKSVDMIMDMFCPPGIKIDAY
PWLECFIKSYNVTNGTDNQICYQIFDTTVAEDVI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R739	0.569	0.569	0.000	634	1.000	1.000	A0A024R739.pdb.gz
2	AFDB:H7BX60	0.699	0.694	0.000	640	0.719	0.713	H7BX60.pdb.gz	H7BX60_MOUSE Protection of telomeres protein 1 OS=Mus musculus OX=10090 GN=Pot1b PE=1 SV=1
3	AFDB:Q91WC1	0.855	0.848	0.000	640	0.757	0.750	Q91WC1.pdb.gz	POTE1_MOUSE Protection of telomeres protein 1 OS=Mus musculus OX=10090 GN=Pot1 PE=1 SV=1
4	AFDB:A0A590UJF7	0.542	0.609	9.191E-102	559	0.882	1.000	A0A590UJF7.pdb.gz	A0A590UJF7_HUMAN Protection of telomeres protein 1 OS=Homo sapiens OX=9606 GN=POT1 PE=1 SV=1
5	AFDB:P62597	0.477	0.390	2.782E-96	778	0.599	0.488	P62597.pdb.gz	POTE1_CHICK Protection of telomeres protein 1 OS=Gallus gallus OX=9031 GN=POT1 PE=1 SV=1
6	AFDB:E7F0D5	0.459	0.378	3.799E-72	773	0.366	0.300	E7F0D5.pdb.gz	E7F0D5_DANRE Protection of telomeres protein 1 OS=Danio rerio OX=7955 GN=pot1 PE=1 SV=1
7	PDB:7qxbP	0.391	0.981	3.512E-43	251	0.391	0.988	7qxbP.pdb.gz	Structural basis of human telomerase recruitment by TPP1-POT1.
8	AFDB:O13988	0.303	0.336	3.123E-26	555	0.159	0.182	O13988.pdb.gz	POT1_SCHPO Protection of telomeres protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pot1 PE=1 SV=2
9	AFDB:Q7Z862	0.204	0.210	1.590E-24	614	0.161	0.166	Q7Z862.pdb.gz	Q7Z862_EMEND Protection of telomeres protein 1 OS=Emericella nidulans OX=162425 GN=nimU PE=3 SV=1
10	PDB:2i0qA	0.263	0.339	1.603E-21	461	0.150	0.206	2i0qA.pdb.gz	Structural reorganization and the cooperative binding of single-stranded telomere DNA in Sterkiella nova.
11	AFDB:P29549	0.263	0.321	1.899E-21	495	0.144	0.184	P29549.pdb.gz	TEBA_STENO Telomere-binding protein subunit alpha OS=Sterkiella nova OX=200597 GN=MAC-56A PE=1 SV=1
12	AFDB:Q56Y52	0.293	0.374	4.865E-21	467	0.164	0.223	Q56Y52.pdb.gz	POT1A_ARATH Protection of telomeres protein 1a OS=Arabidopsis thaliana OX=3702 GN=POT1A PE=1 SV=1
13	PDB:7uy7A	0.144	0.161	6.690E-9	552	0.091	0.105	7uy7A.pdb.gz	Structure of Tetrahymena telomerase-bound CST with polymerase alpha-primase.
14	PDB:7uy5I	0.138	0.158	1.915E-8	528	0.091	0.110	7uy5I.pdb.gz	Structure of Tetrahymena telomerase-bound CST with polymerase alpha-primase.
15	PDB:6w6wA	0.185	0.136	2.364E-6	905	0.076	0.053	6w6wA.pdb.gz	The structure of human CST reveals a decameric assembly bound to telomeric DNA.
16	PDB:8d0bA	0.219	0.134	2.950E-6	1116	0.091	0.052	8d0bA.pdb.gz	Structures of the human CST-Pol alpha-primase complex bound to telomere templates.
17	PDB:4owwB	0.131	0.667	1.344E-4	107	0.028	0.168	4owwB.pdb.gz	Structural Basis of SOSS1 Complex Assembly and Recognition of ssDNA.
18	PDB:7u5cE	0.116	0.084	2.612E-4	1147	0.057	0.031	7u5cE.pdb.gz	Cryo-EM structure of the human CST-Pol alpha /primase complex in a recruitment state.
19	PDB:4abnB	0.117	0.167	3.934E-3	426	0.024	0.035	4abnB.pdb.gz
20	PDB:7uy7B	0.134	0.271	4.158E-3	291	0.025	0.055	7uy7B.pdb.gz	Structure of Tetrahymena telomerase-bound CST with polymerase alpha-primase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A590UJF7	0.0	947	559	0.719	0.816	A0A590UJF7_HUMAN Protection of telomeres protein 1 OS=Homo sapiens OX=9606 GN=POT1 PE=1 SV=1
2	H7BX60	0.0	932	640	0.721	0.714	H7BX60_MOUSE Protection of telomeres protein 1 OS=Mus musculus OX=10090 GN=Pot1b PE=1 SV=1
3	P62597	0.0	797	778	0.599	0.488	POTE1_CHICK Protection of telomeres protein 1 OS=Gallus gallus OX=9031 GN=POT1 PE=1 SV=1
4	Q3TNS5	0.0	866	623	0.675	0.687	Q3TNS5_MOUSE Protection of telomeres protein 1 OS=Mus musculus OX=10090 GN=Pot1b PE=1 SV=1
5	Q91WC1	0.0	993	640	0.757	0.750	POTE1_MOUSE Protection of telomeres protein 1 OS=Mus musculus OX=10090 GN=Pot1 PE=1 SV=1
6	Q9NUX5	0.0	1315	634	1.000	1.000	POTE1_HUMAN Protection of telomeres protein 1 OS=Homo sapiens OX=9606 GN=POT1 PE=1 SV=1
7	A0A3B2WCZ2	1.58e-165	479	352	0.385	0.693	A0A3B2WCZ2_MOUSE Protection of telomeres protein 1 OS=Mus musculus OX=10090 GN=Pot1b PE=1 SV=1
8	E7F0D5	5.07e-135	415	773	0.372	0.305	E7F0D5_DANRE Protection of telomeres protein 1 OS=Danio rerio OX=7955 GN=pot1 PE=1 SV=1
9	F1D6H6	2.93e-134	413	773	0.371	0.304	F1D6H6_DANRE Protection of telomeres protein 1 OS=Danio rerio OX=7955 GN=pot1 PE=1 SV=1
10	A0A3B2WCG4	1.18e-57	192	133	0.151	0.722	A0A3B2WCG4_MOUSE Protection of telomeres 1B (Fragment) OS=Mus musculus OX=10090 GN=Pot1b PE=1 SV=1
11	Q6NKX5	2.85e-07	55.8	454	0.079	0.110	POT1B_ARATH Protection of telomeres protein 1b OS=Arabidopsis thaliana OX=3702 GN=POT1B PE=1 SV=1
12	O13988	2.35e-06	53.1	555	0.153	0.175	POT1_SCHPO Protection of telomeres protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=pot1 PE=1 SV=2
13	P29549	1.27e-04	47.4	495	0.063	0.081	TEBA_STENO Telomere-binding protein subunit alpha OS=Sterkiella nova OX=200597 GN=MAC-56A PE=1 SV=1
14	Q56Y52	0.003	43.1	467	0.073	0.099	POT1A_ARATH Protection of telomeres protein 1a OS=Arabidopsis thaliana OX=3702 GN=POT1A PE=1 SV=1
15	O45595	0.010	40.4	251	0.062	0.155	POT2_CAEEL Protection of telomeres homolog 2 OS=Caenorhabditis elegans OX=6239 GN=pot-2 PE=3 SV=1
16	Q05793	0.37	36.6	3707	0.046	0.008	PGBM_MOUSE Basement membrane-specific heparan sulfate proteoglycan core protein OS=Mus musculus OX=10090 GN=Hspg2 PE=1 SV=1
17	P98160	2.6	33.9	4391	0.058	0.008	PGBM_HUMAN Basement membrane-specific heparan sulfate proteoglycan core protein OS=Homo sapiens OX=9606 GN=HSPG2 PE=1 SV=4
18	Q8NFU5	2.9	33.1	416	0.043	0.065	IPMK_HUMAN Inositol polyphosphate multikinase OS=Homo sapiens OX=9606 GN=IPMK PE=1 SV=1
19	B7ZDJ4	3.0	30.0	62	0.025	0.258	B7ZDJ4_RAT Acetyl-Coenzyme A carboxylase beta (Fragment) OS=Rattus norvegicus OX=10116 GN=Acacb PE=2 SV=1
20	Q9Y7S4	3.9	33.1	576	0.041	0.045	YQO5_SCHPO Uncharacterized transporter C569.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC569.05c PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02765 POT1	7.3e-33	124.9	Telomeric single stranded DNA binding POT1/CDC13
2	PF16686 POT1PC	1.2e-37	140.7	ssDNA-binding domain of telomere protection protein
3	PF01336 tRNA_anti-codon	2.6	19.4	OB-fold nucleic acid binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000350249

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000267415	0.999	TERF1-interacting nuclear factor 2
2	9606.ENSP00000276603	0.999	Telomeric repeat-binding factor 1
3	9606.ENSP00000483117	0.999	Adrenocortical dysplasia protein homolog
4	9606.ENSP00000254942	0.997	Telomeric repeat-binding factor 2
5	9606.ENSP00000300086	0.995	Telomeric repeat-binding factor 2-interacting protein 1
6	9606.ENSP00000358576	0.985	5' exonuclease Apollo
7	9606.ENSP00000298139	0.978	Werner syndrome ATP-dependent helicase
8	9606.ENSP00000347232	0.958	Bloom syndrome protein
9	9606.ENSP00000309572	0.950	Telomerase reverse transcriptase
10	9606.ENSP00000352257	0.949	X-ray repair cross-complementing protein 6
11	9606.ENSP00000313759	0.943	CST complex subunit CTC1
12	9606.ENSP00000305480	0.934	Flap endonuclease 1
13	9606.ENSP00000380762	0.931	CST complex subunit TEN1
14	9606.ENSP00000328174	0.924	ATP-dependent DNA helicase PIF1
15	9606.ENSP00000224950	0.923	CST complex subunit STN1
16	9606.ENSP00000263274	0.910	DNA ligase 1
17	9606.ENSP00000266970	0.909	Cyclin-dependent kinase 2
18	9606.ENSP00000255465	0.906	Cyclin-A1
19	9606.ENSP00000274026	0.903	Cyclin-A2
20	9606.ENSP00000377390	0.902	Serine/threonine-protein phosphatase 6 regulatory subunit 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0043047	0.999	single-stranded telomeric DNA binding
GO:0003684	0.998	damaged DNA binding
GO:0019899	0.997	enzyme binding
GO:0000217	0.993	DNA secondary structure binding
GO:0004857	0.989	enzyme inhibitor activity
GO:0031267	0.907	small GTPase binding
GO:0017151	0.807	DEAD/H-box RNA helicase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044238	0.967	primary metabolic process
GO:0044237	0.967	cellular metabolic process
GO:0006807	0.965	nitrogen compound metabolic process
GO:0043170	0.965	macromolecule metabolic process
GO:0016233	0.960	telomere capping
GO:0060255	0.957	regulation of macromolecule metabolic process
GO:0031323	0.957	regulation of cellular metabolic process
GO:0080090	0.956	regulation of primary metabolic process
GO:0051171	0.956	regulation of nitrogen compound metabolic process
GO:0019219	0.949	regulation of nucleobase-containing compound metabolic process
GO:0034502	0.938	protein localization to chromosome
GO:0032206	0.937	positive regulation of telomere maintenance
GO:0007004	0.934	telomere maintenance via telomerase
GO:2000279	0.933	negative regulation of DNA biosynthetic process
GO:0010639	0.931	negative regulation of organelle organization
GO:2001251	0.913	negative regulation of chromosome organization
GO:1904356	0.910	regulation of telomere maintenance via telomere lengthening
GO:0051972	0.897	regulation of telomerase activity
GO:0032210	0.893	regulation of telomere maintenance via telomerase
GO:0044093	0.864	positive regulation of molecular function
GO:2000573	0.864	positive regulation of DNA biosynthetic process
GO:0071103	0.837	DNA conformation change
GO:0032392	0.829	DNA geometric change
GO:0032508	0.802	DNA duplex unwinding
GO:0044092	0.668	negative regulation of molecular function
GO:0048583	0.616	regulation of response to stimulus
GO:0043085	0.433	positive regulation of catalytic activity
GO:0050896	0.346	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0043232	0.962	intracellular non-membrane-bounded organelle
GO:0032991	0.954	protein-containing complex
GO:0005694	0.842	chromosome
GO:0098687	0.811	chromosomal region
GO:0000781	0.800	chromosome, telomeric region
GO:0140513	0.792	nuclear protein-containing complex
GO:0032993	0.648	protein-DNA complex
GO:0000783	0.621	nuclear telomere cap complex
GO:0005737	0.444	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]