StarFunc result for job id Q9NUZ1

User Input

>input (547 residues)
MRALTVQRVKFAMDLPLLKRAGQDLAEKTKNFVSRSLVIGEVLSMADMATGVKCGIIYWL
FGGAIRNLGSPEHVTKWFQPLQEQKYTGMFAMTERGHGSNARGIQTEATFDLSAQEFVID
TPCENAEKMYIGNAMYGNYAAVFAQLIIDGRSQGPHCFIVPVRDENGSLYPGVTAIDMMY
KEGLHGVDNGILIFDKVRIPRENLLDKFGSVAPDGQYHSPIRNKSARFNAMLAALTPSRL
AVAFQAMGAMKLGLTIAIRYSHSRRQFGPKTKEEVKIIEHQTQTLRLMPHLATALALTFV
SRYAGALLDEDVFQGKELVNSRSLQALVAGLKAYSTWENIRCLQDCRECTGGMGYMMENR
ISGLKCDTDVFATFEGDDVVMLQVVGRELLAQYTKQYEEKPLFGLLQNWAESVGDKLRTS
FLAFNMDTVDDLAFLLKAVKFRERVLQRGLVARIYYKVKTKKEDFFHAWNSCLHHVASLS
LAHTHRVTLEQFSLAVKSCPDQEDQTLLMKFCLLYGTKLVFQERAWYLEHKYLTPMASTR
IRNQERC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NUZ1	1.000	1.000	1.663E-82	547	1.000	1.000	Q9NUZ1.pdb.gz	ACOXL_HUMAN Acyl-coenzyme A oxidase-like protein OS=Homo sapiens OX=9606 GN=ACOXL PE=2 SV=3
2	AFDB:O65201	0.938	0.745	7.425E-40	692	0.386	0.305	O65201.pdb.gz	ACOX2_ARATH Acyl-coenzyme A oxidase 2, peroxisomal OS=Arabidopsis thaliana OX=3702 GN=ACX2 PE=1 SV=2
3	AFDB:P0CZ23	0.900	0.732	7.250E-37	675	0.320	0.259	P0CZ23.pdb.gz	ACOX3_ARATH Acyl-coenzyme A oxidase 3, peroxisomal OS=Arabidopsis thaliana OX=3702 GN=ACX3 PE=1 SV=1
4	AFDB:O15254	0.884	0.697	2.366E-35	700	0.300	0.234	O15254.pdb.gz	ACOX3_HUMAN Peroxisomal acyl-coenzyme A oxidase 3 OS=Homo sapiens OX=9606 GN=ACOX3 PE=1 SV=2
5	AFDB:Q9EPL9	0.901	0.708	5.908E-35	700	0.307	0.240	Q9EPL9.pdb.gz	ACOX3_MOUSE Peroxisomal acyl-coenzyme A oxidase 3 OS=Mus musculus OX=10090 GN=Acox3 PE=1 SV=2
6	AFDB:Q63448	0.908	0.715	6.733E-35	700	0.322	0.251	Q63448.pdb.gz	ACOX3_RAT Peroxisomal acyl-coenzyme A oxidase 3 OS=Rattus norvegicus OX=10116 GN=Acox3 PE=1 SV=1
7	AFDB:Q95TH0	0.919	0.731	9.195E-34	693	0.274	0.216	Q95TH0.pdb.gz	Q95TH0_DROME Acyl-coenzyme A oxidase OS=Drosophila melanogaster OX=7227 GN=CG17544 PE=2 SV=1
8	AFDB:P07872	0.816	0.680	2.733E-33	661	0.296	0.245	P07872.pdb.gz	ACOX1_RAT Peroxisomal acyl-coenzyme A oxidase 1 OS=Rattus norvegicus OX=10116 GN=Acox1 PE=1 SV=1
9	AFDB:Q15067	0.829	0.692	2.212E-32	660	0.296	0.245	Q15067.pdb.gz	ACOX1_HUMAN Peroxisomal acyl-coenzyme A oxidase 1 OS=Homo sapiens OX=9606 GN=ACOX1 PE=1 SV=3
10	PDB:1is2A	0.778	0.673	3.481E-32	637	0.285	0.245	1is2A.pdb.gz	Three-dimensional structure of the flavoenzyme acyl-CoA oxidase-II from rat liver, the peroxisomal counterpart of mitochondrial acyl-CoA dehydrogenase.
11	AFDB:Q20992	0.880	0.726	1.379E-31	667	0.296	0.243	Q20992.pdb.gz	ACX3_CAEEL Acyl-coenzyme A oxidase acox-3 OS=Caenorhabditis elegans OX=6239 GN=acox-3 PE=1 SV=1
12	PDB:1w07B	0.788	0.660	1.610E-30	658	0.256	0.213	1w07B.pdb.gz	Acyl-Coa Oxidase 1 from Arabidopsis Thaliana. Structure of a Key Enzyme in Plant Lipid Metabolism
13	PDB:5k3iA	0.818	0.681	1.102E-28	661	0.265	0.219	5k3iA.pdb.gz	Structural characterization of acyl-CoA oxidases reveals a direct link between pheromone biosynthesis and metabolic state in Caenorhabditis elegans.
14	PDB:5k3jA	0.784	0.651	9.736E-28	662	0.260	0.215	5k3jA.pdb.gz	Structural characterization of acyl-CoA oxidases reveals a direct link between pheromone biosynthesis and metabolic state in Caenorhabditis elegans.
15	PDB:5k3hB	0.787	0.682	1.281E-25	635	0.256	0.220	5k3hB.pdb.gz
16	PDB:7s7gA	0.611	0.587	2.631E-15	571	0.165	0.158	7s7gA.pdb.gz	Crystal Structure Analysis of Human VLCAD
17	PDB:1jqiA	0.538	0.750	7.166E-15	384	0.165	0.234	1jqiA.pdb.gz	Crystal structure of rat short chain acyl-CoA dehydrogenase complexed with acetoacetyl-CoA: comparison with other acyl-CoA dehydrogenases.
18	PDB:2a1tC	0.569	0.789	7.166E-15	388	0.146	0.206	2a1tC.pdb.gz	Stabilization of Non-productive Conformations Underpins Rapid Electron Transfer to Electron-transferring Flavoprotein
19	PDB:6kseA	0.619	0.564	2.039E-14	607	0.154	0.138	6kseA.pdb.gz	Structural basis for the broad substrate specificity of two acyl-CoA dehydrogenases FadE5 from mycobacteria.
20	PDB:2r0mA	0.527	0.725	2.130E-14	390	0.135	0.190	2r0mA.pdb.gz	The effect of a Glu370Asp mutation in glutaryl-CoA dehydrogenase on proton transfer to the dienolate intermediate.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9NUZ1	0.0	1147	547	1.000	1.000	ACOXL_HUMAN Acyl-coenzyme A oxidase-like protein OS=Homo sapiens OX=9606 GN=ACOXL PE=2 SV=3
2	O65201	4.26e-110	345	692	0.380	0.301	ACOX2_ARATH Acyl-coenzyme A oxidase 2, peroxisomal OS=Arabidopsis thaliana OX=3702 GN=ACX2 PE=1 SV=2
3	P0CZ23	1.38e-90	294	675	0.287	0.233	ACOX3_ARATH Acyl-coenzyme A oxidase 3, peroxisomal OS=Arabidopsis thaliana OX=3702 GN=ACX3 PE=1 SV=1
4	Q63448	1.82e-72	246	700	0.316	0.247	ACOX3_RAT Peroxisomal acyl-coenzyme A oxidase 3 OS=Rattus norvegicus OX=10116 GN=Acox3 PE=1 SV=1
5	Q9EPL9	9.03e-71	242	700	0.305	0.239	ACOX3_MOUSE Peroxisomal acyl-coenzyme A oxidase 3 OS=Mus musculus OX=10090 GN=Acox3 PE=1 SV=2
6	O15254	9.68e-70	239	700	0.283	0.221	ACOX3_HUMAN Peroxisomal acyl-coenzyme A oxidase 3 OS=Homo sapiens OX=9606 GN=ACOX3 PE=1 SV=2
7	P07872	1.21e-69	238	661	0.300	0.248	ACOX1_RAT Peroxisomal acyl-coenzyme A oxidase 1 OS=Rattus norvegicus OX=10116 GN=Acox1 PE=1 SV=1
8	Q9R0H0	1.63e-69	238	661	0.300	0.248	ACOX1_MOUSE Peroxisomal acyl-coenzyme A oxidase 1 OS=Mus musculus OX=10090 GN=Acox1 PE=1 SV=5
9	Q15067	3.73e-63	220	660	0.289	0.239	ACOX1_HUMAN Peroxisomal acyl-coenzyme A oxidase 1 OS=Homo sapiens OX=9606 GN=ACOX1 PE=1 SV=3
10	Q95TH0	3.88e-61	216	693	0.250	0.198	Q95TH0_DROME Acyl-coenzyme A oxidase OS=Drosophila melanogaster OX=7227 GN=CG17544 PE=2 SV=1
11	Q9VIX4	4.12e-61	215	693	0.250	0.198	Q9VIX4_DROME Acyl-coenzyme A oxidase OS=Drosophila melanogaster OX=7227 GN=Dmel\CG17544 PE=1 SV=2
12	Q20992	6.64e-59	209	667	0.307	0.252	ACX3_CAEEL Acyl-coenzyme A oxidase acox-3 OS=Caenorhabditis elegans OX=6239 GN=acox-3 PE=1 SV=1
13	O65202	1.79e-48	180	664	0.214	0.176	ACOX1_ARATH Peroxisomal acyl-coenzyme A oxidase 1 OS=Arabidopsis thaliana OX=3702 GN=ACX1 PE=1 SV=1
14	O02767	3.08e-48	180	681	0.225	0.181	ACOX2_RABIT Peroxisomal acyl-coenzyme A oxidase 2 OS=Oryctolagus cuniculus OX=9986 GN=ACOX2 PE=1 SV=1
15	O62139	2.26e-47	177	662	0.267	0.221	ACX14_CAEEL Acyl-coenzyme A oxidase acox-1.4 OS=Caenorhabditis elegans OX=6239 GN=acox-1.4 PE=1 SV=1
16	O62140	2.28e-47	177	674	0.283	0.230	ACX11_CAEEL Acyl-coenzyme A oxidase acox-1.1 OS=Caenorhabditis elegans OX=6239 GN=acox-1.1 PE=1 SV=1
17	O62137	3.17e-46	174	661	0.265	0.219	ACX12_CAEEL Acyl-coenzyme A oxidase acox-1.2 OS=Caenorhabditis elegans OX=6239 GN=acox-1.2 PE=1 SV=2
18	P97562	2.15e-45	172	681	0.272	0.219	ACOX2_RAT Peroxisomal acyl-coenzyme A oxidase 2 OS=Rattus norvegicus OX=10116 GN=Acox2 PE=1 SV=1
19	Q5AY78	2.32e-45	172	696	0.221	0.174	Q5AY78_EMENI Acyl-coenzyme A oxidase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=ANIA_06752 PE=3 SV=1
20	Q9ZQP2	2.54e-45	171	664	0.199	0.164	ACO12_ARATH Putative peroxisomal acyl-coenzyme A oxidase 1.2 OS=Arabidopsis thaliana OX=3702 GN=ACX1.2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01756 ACOX	8.6e-08	43.4	Acyl-CoA oxidase
2	PF00441 Acyl-CoA_dh_1	7.9e-10	50.6	Acyl-CoA dehydrogenase, C-terminal domain
3	PF02770 Acyl-CoA_dh_M	7.2e-09	47.0	Acyl-CoA dehydrogenase, middle domain
4	PF02022 Integrase_Zn	1.3e+02	14.0	Integrase Zinc binding domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9601.ENSPPYP00000013552

Rank	PPI partner	STRING score	Description
1	9601.ENSPPYP00000005664	0.941	acyl-CoA dehydrogenase family, member 10
2	9601.ENSPPYP00000015674	0.921	acetyl-CoA acyltransferase 1
3	9601.ENSPPYP00000008636	0.852	acyl-CoA synthetase family member 3
4	9601.ENSPPYP00000014051	0.845	Uncharacterized protein
5	9601.ENSPPYP00000016064	0.845	Peroxisomal bifunctional enzyme
6	9601.ENSPPYP00000001558	0.835	Pongo abelii sterol carrier protein 2 (SCP2), mRNA
7	9601.ENSPPYP00000018110	0.809	enoyl-CoA delta isomerase 2
8	9601.ENSPPYP00000017571	0.781	Hydroxysteroid (17-beta) dehydrogenase 4
9	9601.ENSPPYP00000021856	0.747	Has apparently no steroid dehydrogenase activity.
10	9601.ENSPPYP00000020695	0.723	Epoxide hydrolase 2, cytoplasmic
11	9601.ENSPPYP00000024526	0.705	Catalase
12	9601.ENSPPYP00000011133	0.676	Isomerization of 3-trans,5-cis-dienoyl-CoA to 2-trans,4- trans-dienoyl-CoA
13	9601.ENSPPYP00000004816	0.661	Peroxisomal biogenesis factor 5
14	9601.ENSPPYP00000016019	0.661	Peroxisomal biogenesis factor 5-like
15	9601.ENSPPYP00000017186	0.656	alpha-methylacyl-CoA racemase
16	9601.ENSPPYP00000019743	0.656	succinyl-CoA:glutarate-CoA transferase
17	9601.ENSPPYP00000009305	0.651	Acyl-CoA synthases catalyze the initial reaction in fatty acid metabolism, by forming a thioester with CoA. Has some preference toward medium-chain substrates. Plays a role in adipocyte differentiation
18	9601.ENSPPYP00000013481	0.646	Lysozyme G-like 2
19	9601.ENSPPYP00000009205	0.645	Peroxisome assembly protein 12
20	9601.ENSPPYP00000013561	0.645	Fibulin 7

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005488	0.999	binding
GO:0016627	0.999	oxidoreductase activity, acting on the CH-CH group of donors
GO:0005515	0.994	protein binding
GO:0016634	0.971	oxidoreductase activity, acting on the CH-CH group of donors, oxygen as acceptor
GO:0036094	0.951	small molecule binding
GO:0043168	0.943	anion binding
GO:0097159	0.901	organic cyclic compound binding
GO:0000166	0.879	nucleotide binding
GO:0003997	0.798	acyl-CoA oxidase activity
GO:0050660	0.376	flavin adenine dinucleotide binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.998	organic substance metabolic process
GO:0044237	0.996	cellular metabolic process
GO:0044238	0.995	primary metabolic process
GO:0044255	0.989	cellular lipid metabolic process
GO:0032787	0.988	monocarboxylic acid metabolic process
GO:0006631	0.971	fatty acid metabolic process
GO:0016042	0.966	lipid catabolic process
GO:0006635	0.962	fatty acid beta-oxidation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0070013	0.999	intracellular organelle lumen
GO:0005777	0.992	peroxisome
GO:0031907	0.923	microbody lumen
GO:0005782	0.901	peroxisomal matrix
GO:0005829	0.821	cytosol
GO:0031981	0.388	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.3.-.-	0.999	Acting on the CH-CH group of donors.
EC:1.3.3.-	0.971	With oxygen as acceptor.
RHEA:38959	0.798	a 2,3-saturated acyl-CoA + O2 = a (2E)-enoyl-CoA + H2O2
EC:1.3.3.6	0.798	acyl-CoA oxidase.

[back to server]