StarFunc result for job id Q9NV23

User Input

>input (265 residues)
MERGDQPKRTRNENIFNCLYKNPEATFKLICFPWMGGGSTHFAKWGQDTHDLLEVHSLRL
PGRESRVEEPLENDISQLVDEVVCALQPVIQDKPFAFFGHSMGSYIAFRTALGLKENNQP
EPLHLFLSSATPVHSKAWHRIPKDDELSEEQISHYLMEFGGTPKHFAEAKEFVKQCSPII
RADLNIVRSCTSNVPSKAVLSCDLTCFVGSEDIAKDMEAWKDVTSGNAKIYQLPGGHFYL
LDPANEKLIKNYIIKCLEVSSISNF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NV23	1.000	1.000	1.560E-55	265	1.000	1.000	Q9NV23.pdb.gz	SAST_HUMAN S-acyl fatty acid synthase thioesterase, medium chain OS=Homo sapiens OX=9606 GN=OLAH PE=1 SV=1
2	AFDB:P08635	0.896	0.902	2.611E-36	263	0.558	0.563	P08635.pdb.gz	SAST_RAT S-acyl fatty acid synthase thioesterase, medium chain OS=Rattus norvegicus OX=10116 GN=Olah PE=1 SV=1
3	PDB:4xjvA	0.765	0.931	1.695E-35	216	0.815	1.000	4xjvA.pdb.gz
4	AFDB:Q9ZGI1	0.840	0.795	2.312E-20	281	0.264	0.249	Q9ZGI1.pdb.gz	PIKA5_STRVZ Thioesterase PikA5 OS=Streptomyces venezuelae OX=54571 GN=pikAV PE=1 SV=1
5	AFDB:Q9I156	0.780	0.811	2.926E-20	254	0.238	0.248	Q9I156.pdb.gz	Q9I156_PSEAE PvdG OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=pvdG PE=3 SV=1
6	AFDB:Q9HWG2	0.783	0.824	4.671E-19	251	0.242	0.255	Q9HWG2.pdb.gz	Q9HWG2_PSEAE Pyochelin biosynthetic protein PchC OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=pchC PE=3 SV=1
7	AFDB:P9WQD5	0.673	0.683	1.592E-15	261	0.257	0.261	P9WQD5.pdb.gz	TESA_MYCTU Thioesterase TesA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=tesA PE=1 SV=1
8	AFDB:P9WQ63	0.747	0.156	5.174E-15	1414	0.219	0.041	P9WQ63.pdb.gz	MBTB_MYCTU Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=mbtB PE=1 SV=1
9	PDB:6fvjD	0.619	0.721	1.162E-14	223	0.242	0.287	6fvjD.pdb.gz	Biochemical and Structural Characterization of TesA, a Major Thioesterase Required for Outer-Envelope Lipid Biosynthesis in Mycobacterium tuberculosis.
10	AFDB:Q5B7T4	0.693	0.220	9.183E-11	938	0.185	0.052	Q5B7T4.pdb.gz	MICA_EMENI Microperfuranone synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=micA PE=3 SV=1
11	AFDB:A7XRY0	0.679	0.216	1.561E-10	970	0.170	0.046	A7XRY0.pdb.gz	TDIA_EMENI Didemethylasterriquinone D synthetase tdiA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=tdiA PE=1 SV=1
12	AFDB:O86335	0.682	0.149	1.561E-10	1402	0.162	0.031	O86335.pdb.gz	O86335_MYCTU Probable membrane bound polyketide synthase Pks6 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=pks6 PE=1 SV=1
13	PDB:5ja2A	0.614	0.154	6.323E-10	1238	0.147	0.032	5ja2A.pdb.gz	Structures of a Nonribosomal Peptide Synthetase Module Bound to MbtH-like Proteins Support a Highly Dynamic Domain Architecture.
14	PDB:6ap6A	0.630	0.632	2.927E-9	264	0.151	0.152	6ap6A.pdb.gz	Inhibition of strigolactone receptors byN-phenylanthranilic acid derivatives: Structural and functional insights.
15	PDB:6eicB	0.568	0.542	3.930E-9	279	0.170	0.161	6eicB.pdb.gz
16	PDB:4gdmC	0.600	0.611	6.680E-9	259	0.136	0.139	4gdmC.pdb.gz	Crystal Structures of E. coli Native MenH and Two Active Site Mutants.
17	PDB:3e3aB	0.554	0.536	9.515E-9	275	0.132	0.127	3e3aB.pdb.gz
18	PDB:4htaA	0.582	0.572	2.171E-8	271	0.132	0.129	4htaA.pdb.gz
19	PDB:5jzsB	0.556	0.526	2.171E-8	284	0.132	0.123	5jzsB.pdb.gz	Investigation of the mycobacterial enzyme HsaD as a potential novel target for anti-tubercular agents using a fragment-based drug design approach.
20	PDB:2y6vC	0.604	0.443	2.443E-8	377	0.143	0.101	2y6vC.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9NV23	0.0	556	265	1.000	1.000	SAST_HUMAN S-acyl fatty acid synthase thioesterase, medium chain OS=Homo sapiens OX=9606 GN=OLAH PE=1 SV=1
2	P08635	1.75e-112	326	263	0.558	0.563	SAST_RAT S-acyl fatty acid synthase thioesterase, medium chain OS=Rattus norvegicus OX=10116 GN=Olah PE=1 SV=1
3	Q9HWG2	2.23e-26	105	251	0.260	0.275	Q9HWG2_PSEAE Pyochelin biosynthetic protein PchC OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=pchC PE=3 SV=1
4	Q9ZGI1	3.93e-26	105	281	0.253	0.238	PIKA5_STRVZ Thioesterase PikA5 OS=Streptomyces venezuelae OX=54571 GN=pikAV PE=1 SV=1
5	Q9I156	2.51e-24	100	254	0.249	0.260	Q9I156_PSEAE PvdG OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=pvdG PE=3 SV=1
6	P9WQD5	1.19e-20	90.1	261	0.249	0.253	TESA_MYCTU Thioesterase TesA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=tesA PE=1 SV=1
7	P9WQ63	2.16e-10	63.2	1414	0.219	0.041	MBTB_MYCTU Phenyloxazoline synthase MbtB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=mbtB PE=1 SV=1
8	Q70AZ6	0.002	42.0	1865	0.162	0.023	Q70AZ6_ACTTI Non-ribosomal peptide synthetase OS=Actinoplanes teichomyceticus OX=1867 GN=tcp12 PE=1 SV=1
9	Q0VZ70	0.016	39.3	3912	0.072	0.005	CHSAD_CHOCO Chondramide synthase cmdD OS=Chondromyces crocatus OX=52 GN=cmdD PE=1 SV=1
10	A0A0U1RQF0	2.7	32.0	2509	0.091	0.010	A0A0U1RQF0_HUMAN Fatty acid synthase OS=Homo sapiens OX=9606 GN=FASN PE=1 SV=1
11	P49327	2.7	32.0	2511	0.091	0.010	FAS_HUMAN Fatty acid synthase OS=Homo sapiens OX=9606 GN=FASN PE=1 SV=3
12	Q5B7T4	4.8	31.2	938	0.098	0.028	MICA_EMENI Microperfuranone synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=micA PE=3 SV=1
13	O35678	5.6	30.4	303	0.106	0.092	MGLL_MOUSE Monoglyceride lipase OS=Mus musculus OX=10090 GN=Mgll PE=1 SV=1
14	Q03133	6.1	30.8	3172	0.094	0.008	ERYA3_SACER 6-deoxyerythronolide-B synthase EryA3, modules 5 and 6 OS=Saccharopolyspora erythraea OX=1836 GN=eryA PE=1 SV=4
15	Q0E9G4	6.2	30.4	381	0.162	0.113	Q0E9G4_DROME CG1600-PA OS=Drosophila melanogaster OX=7227 GN=Drat PE=1 SV=1
16	O23227	6.4	30.4	378	0.068	0.048	O23227_ARATH Alpha/beta-Hydrolases superfamily protein OS=Arabidopsis thaliana OX=3702 GN=C7A10.830 PE=1 SV=2
17	Q6UXT8	6.4	29.6	129	0.079	0.163	ALKL1_HUMAN ALK and LTK ligand 1 OS=Homo sapiens OX=9606 GN=ALKAL1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00561 Abhydrolase_1	0.038	25.2	alpha/beta hydrolase fold
2	PF12697 Abhydrolase_6	0.95	21.6	Alpha/beta hydrolase family
3	PF12146 Hydrolase_4	1.1	20.0	Serine aminopeptidase, S33
4	PF10230 LIDHydrolase	2e+02	12.9	Lipid-droplet associated hydrolase
5	PF01764 Lipase_3	1.9e+02	13.3	Lipase (class 3)
6	PF00975 Thioesterase	3.8e-36	136.9	Thioesterase domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_008954839.1

Rank	PPI partner	STRING score	Description
1	9597.XP_003831135.1	0.980	Fatty acid synthase
2	9597.XP_003826203.1	0.946	May play a role in the biosynthesis of lipoic acid as well as longer chain fatty acids required for optimal mitochondrial function.
3	9597.XP_003828155.1	0.928	Mitochondrial trans-2-enoyl-CoA reductase
4	9597.XP_003846002.1	0.800	Lipoyltransferase 1
5	9597.XP_008952631.1	0.688	Aminoadipate-semialdehyde dehydrogenase
6	9597.XP_008952613.1	0.687	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 20 ESTs, and 100% coverage of the annotated genomic feature by RNAseq alignments, including 4 samples with support for all annotated introns
7	9597.XP_003828402.1	0.563	Aminoadipate-semialdehyde dehydrogenase-phosphopantetheinyl transferase
8	9597.XP_003832126.1	0.514	Abhydrolase domain containing 13
9	9597.XP_003832111.1	0.508	Testis-expressed sequence 30 protein isoform X1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016297	0.999	acyl-[acyl-carrier-protein] hydrolase activity
GO:0005488	0.908	binding
GO:0005515	0.819	protein binding
GO:0016296	0.585	palmitoyl-[acyl-carrier-protein] hydrolase activity
GO:0016295	0.585	myristoyl-[acyl-carrier-protein] hydrolase activity
GO:0047381	0.584	dodecanoyl-[acyl-carrier-protein] hydrolase activity
GO:0052689	0.415	carboxylic ester hydrolase activity
GO:0016298	0.312	lipase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006629	0.997	lipid metabolic process
GO:0046394	0.997	carboxylic acid biosynthetic process
GO:0032787	0.995	monocarboxylic acid metabolic process
GO:0006633	0.987	fatty acid biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043226	0.720	organelle
GO:0043227	0.704	membrane-bounded organelle
GO:0043229	0.703	intracellular organelle
GO:0043231	0.682	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:30131	0.999	H2O + octanoyl-[ACP] = H(+) + holo-[ACP] + octanoate
EC:3.1.2.14	0.999	oleoyl-[acyl-carrier-protein] hydrolase.
RHEA:41932	0.585	H2O + hexadecanoyl-[ACP] = H(+) + hexadecanoate + holo-[ACP]
RHEA:30123	0.585	H2O + tetradecanoyl-[ACP] = H(+) + holo-[ACP] + tetradecanoate
RHEA:30119	0.584	dodecanoyl-[ACP] + H2O = dodecanoate + H(+) + holo-[ACP]
EC:3.1.2.21	0.584	dodecanoyl-[acyl-carrier-protein] hydrolase.
EC:3.1.1.-	0.415	Carboxylic ester hydrolases.

[back to server]