StarFunc result for job id Q9NV29

User Input

>input (134 residues)
MTEEPIKEILGAPKAHMAATMEKSPKSEVVITTVPLVSEIQLMAATGGTELSCYRCIIPF
AVVVFIAGIVVTAVAYSFNSHGSIISIFGLVVLSSGLFLLASSALCWKVRQRSKKAKRRE
SQTALVANQRSLFA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NV29	1.000	1.000	1.071E-18	134	1.000	1.000	Q9NV29.pdb.gz	TM100_HUMAN Transmembrane protein 100 OS=Homo sapiens OX=9606 GN=TMEM100 PE=1 SV=2
2	AFDB:Q9CQG9	0.670	0.670	3.180E-15	134	0.851	0.851	Q9CQG9.pdb.gz	TM100_MOUSE Transmembrane protein 100 OS=Mus musculus OX=10090 GN=Tmem100 PE=1 SV=1
3	AFDB:Q8BFY0	0.386	0.383	2.257E-2	135	0.179	0.178	Q8BFY0.pdb.gz	PIRT_MOUSE Phosphoinositide-interacting protein OS=Mus musculus OX=10090 GN=Pirt PE=1 SV=1
4	AFDB:D2JX42	0.532	0.503	6.181E-2	143	0.119	0.112	D2JX42.pdb.gz	D2JX42_MUSPR Abscisic stress ripening OS=Musa AAB Group OX=485264 GN=ASR1 PE=3 SV=1
5	AFDB:Q94JM4	0.287	0.169	7.951E-2	273	0.172	0.084	Q94JM4.pdb.gz	Q94JM4_ARATH AT4g19390/T5K18_170 OS=Arabidopsis thaliana OX=3702 GN=At4g19390 PE=1 SV=1
6	AFDB:Q9H6X4	0.223	0.171	1.589E-1	195	0.127	0.087	Q9H6X4.pdb.gz	TM134_HUMAN Transmembrane protein 134 OS=Homo sapiens OX=9606 GN=TMEM134 PE=1 SV=1
7	AFDB:Q6P5S7	0.311	0.305	1.802E-1	137	0.142	0.139	Q6P5S7.pdb.gz	RNK_HUMAN Ribonuclease kappa OS=Homo sapiens OX=9606 GN=RNASEK PE=1 SV=2
8	AFDB:Q7KBL8	0.354	0.272	2.469E-1	188	0.134	0.096	Q7KBL8.pdb.gz	MED29_DROME Mediator of RNA polymerase II transcription subunit 29 OS=Drosophila melanogaster OX=7227 GN=ix PE=1 SV=1
9	AFDB:B9FMJ3	0.358	0.092	3.603E-1	819	0.142	0.023	B9FMJ3.pdb.gz	KN13A_ORYSJ Kinesin-like protein KIN-13A OS=Oryza sativa subsp. japonica OX=39947 GN=KIN13A PE=1 SV=1
10	AFDB:P13658	0.277	0.086	4.086E-1	517	0.097	0.025	P13658.pdb.gz	MBEA_ECOLX DNA relaxase MbeA OS=Escherichia coli OX=562 GN=mbeA PE=1 SV=1
11	PDB:5c0wL	0.425	0.497	4.788E-1	113	0.052	0.062	5c0wL.pdb.gz	RNA degradation paths in a 12-subunit nuclear exosome complex.
12	PDB:7w6sB	0.184	0.088	6.986E-1	448	0.194	0.058	7w6sB.pdb.gz
13	PDB:7f3fA	0.168	0.078	9.571E-1	460	0.209	0.061	7f3fA.pdb.gz
14	PDB:6s1kE	0.399	0.492	1.687	102	0.067	0.088	6s1kE.pdb.gz
15	PDB:4o93A	0.202	0.267	1.913	94	0.127	0.181	4o93A.pdb.gz
16	PDB:1f4nA	0.347	0.737	2.037	59	0.037	0.085	1f4nA.pdb.gz	Dramatic structural and thermodynamic consequences of repacking a protein's hydrophobic core.
17	PDB:4d2eE	0.366	0.509	2.037	90	0.052	0.078	4d2eE.pdb.gz	Cell-Free Expression and in Meso Crystallisation of an Integral Membrane Kinase for Structure Determination.
18	PDB:6s7oC	0.321	0.527	2.037	78	0.067	0.115	6s7oC.pdb.gz	Cryo-electron microscopy structures of human oligosaccharyltransferase complexes OST-A and OST-B.
19	PDB:4h54A	0.195	0.100	2.311	274	0.067	0.033	4h54A.pdb.gz	Structure and signaling mechanism of a zinc-sensory diguanylate cyclase.
20	PDB:6v4uB	0.388	0.142	2.461	421	0.060	0.019	6v4uB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9NV29	2.38e-94	270	134	1.000	1.000	TM100_HUMAN Transmembrane protein 100 OS=Homo sapiens OX=9606 GN=TMEM100 PE=1 SV=2
2	Q9CQG9	5.17e-79	231	134	0.851	0.851	TM100_MOUSE Transmembrane protein 100 OS=Mus musculus OX=10090 GN=Tmem100 PE=1 SV=1
3	Q95SI0	2.6	30.0	509	0.090	0.024	Q95SI0_DROME receptor protein serine/threonine kinase OS=Drosophila melanogaster OX=7227 GN=tkv PE=1 SV=1
4	Q8IPK9	2.7	30.0	531	0.090	0.023	Q8IPK9_DROME receptor protein serine/threonine kinase OS=Drosophila melanogaster OX=7227 GN=tkv PE=3 SV=1
5	Q7KTP1	2.8	30.0	563	0.090	0.021	Q7KTP1_DROME receptor protein serine/threonine kinase OS=Drosophila melanogaster OX=7227 GN=tkv PE=2 SV=1
6	Q24326	2.9	30.0	563	0.090	0.021	Q24326_DROME receptor protein serine/threonine kinase OS=Drosophila melanogaster OX=7227 GN=tkv PE=2 SV=1
7	Q9VMT1	3.0	29.6	575	0.090	0.021	Q9VMT1_DROME receptor protein serine/threonine kinase OS=Drosophila melanogaster OX=7227 GN=tkv PE=2 SV=2
8	B8JI13	4.4	29.3	1345	0.104	0.010	B8JI13_DANRE Attractin OS=Danio rerio OX=7955 GN=si:dkey-259n11.1 PE=1 SV=1
9	O75882	4.4	29.3	1429	0.104	0.010	ATRN_HUMAN Attractin OS=Homo sapiens OX=9606 GN=ATRN PE=1 SV=2
10	Q99J86	4.4	29.3	1432	0.104	0.010	ATRN_RAT Attractin OS=Rattus norvegicus OX=10116 GN=Atrn PE=2 SV=1
11	Q9WU60	4.4	29.3	1428	0.104	0.010	ATRN_MOUSE Attractin OS=Mus musculus OX=10090 GN=Atrn PE=1 SV=3
12	Q7JQ37	6.0	28.9	563	0.067	0.016	Q7JQ37_DROME receptor protein serine/threonine kinase OS=Drosophila melanogaster OX=7227 GN=tkv PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13903 Claudin_2	10	17.3	PMP-22/EMP/MP20/Claudin tight junction
2	PF09972 DUF2207	5.9e+02	10.6	Predicted membrane protein (DUF2207)
3	PF14927 Neurensin	57	14.8	Neurensin
4	PF15099 PIRT	1.6	19.9	Phosphoinositide-interacting protein family
5	PF01944 SpoIIM	13	17.3	Stage II sporulation protein M
6	PF16311 TMEM100	1.4e-63	223.9	Transmembrane protein 100

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000465638

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000254770	0.672	LanC-like protein 2
2	9606.ENSP00000262209	0.648	Transient receptor potential cation channel subfamily A member 1
3	9606.ENSP00000374234	0.599	Transmembrane protein 72
4	9606.ENSP00000439625	0.598	Pleckstrin homology domain-containing family G member 5
5	9606.ENSP00000337446	0.565	StAR-related lipid transfer protein 3
6	9606.ENSP00000268896	0.535	Phosphatidylcholine transfer protein
7	9606.ENSP00000368411	0.501	Amiloride-sensitive sodium channel subunit delta

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0050794	0.994	regulation of cellular process
GO:0050896	0.968	response to stimulus
GO:0051716	0.948	cellular response to stimulus
GO:0009719	0.894	response to endogenous stimulus
GO:0070848	0.877	response to growth factor
GO:0007167	0.868	enzyme-linked receptor protein signaling pathway
GO:0071772	0.834	response to BMP
GO:0007178	0.821	transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0071495	0.796	cellular response to endogenous stimulus
GO:0071773	0.779	cellular response to BMP stimulus
GO:0030509	0.692	BMP signaling pathway
GO:0032501	0.490	multicellular organismal process
GO:0048518	0.404	positive regulation of biological process
GO:0048522	0.361	positive regulation of cellular process
GO:0032502	0.347	developmental process
GO:0048856	0.318	anatomical structure development
GO:0007275	0.308	multicellular organism development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0048471	1.000	perinuclear region of cytoplasm
GO:0005886	1.000	plasma membrane
GO:0043204	1.000	perikaryon
GO:0012505	0.970	endomembrane system
GO:0043231	0.966	intracellular membrane-bounded organelle
GO:0005783	0.489	endoplasmic reticulum

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]