StarFunc result for job id Q9NV56

User Input

>input (204 residues)
MGEAEVGGGGAAGDKGPGEAATSPAEETVVWSPEVEVCLFHAMLGHKPVGVNRHFHMICI
RDKFSQNIGRQVPSKVIWDHLSTMYDMQALHESEILPFPNPERNFVLPEEIIQEVREGKV
MIEEEMKEEMKEDVDPHNGADDVFSSSGSLGKASEKSSKDKEKNSSDLGCKEGADKRKRS
RVTDKVLTANSNPSSPSAAKRRRT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NV56	0.999	0.999	9.449E-30	204	1.000	1.000	Q9NV56.pdb.gz	MRGBP_HUMAN MRG/MORF4L-binding protein OS=Homo sapiens OX=9606 GN=MRGBP PE=1 SV=1
2	AFDB:Q7K003	0.399	0.404	1.738E-11	201	0.338	0.343	Q7K003.pdb.gz	Q7K003_DROME MRG/MORF4L binding protein OS=Drosophila melanogaster OX=7227 GN=MrgBP PE=1 SV=1
3	AFDB:Q5A6Q7	0.297	0.140	5.461E-4	445	0.162	0.074	Q5A6Q7.pdb.gz	EAF7_CANAL Chromatin modification-related protein EAF7 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=EAF7 PE=3 SV=1
4	AFDB:P70210	0.222	0.110	4.765E-2	439	0.152	0.071	P70210.pdb.gz	TEAD3_MOUSE Transcriptional enhancer factor TEF-5 OS=Mus musculus OX=10090 GN=Tead3 PE=1 SV=2
5	AFDB:Q19849	0.235	0.104	8.266E-2	486	0.142	0.060	Q19849.pdb.gz	EGL44_CAEEL Transcription enhancer factor-like protein egl-44 OS=Caenorhabditis elegans OX=6239 GN=egl-44 PE=1 SV=4
6	AFDB:A0A024QZE2	0.227	0.109	9.932E-2	450	0.162	0.073	A0A024QZE2.pdb.gz
7	AFDB:Q9C6K3	0.212	0.082	1.349E-1	603	0.137	0.046	Q9C6K3.pdb.gz	DF1_ARATH Trihelix transcription factor DF1 OS=Arabidopsis thaliana OX=3702 GN=DF1 PE=4 SV=1
8	AFDB:Q9LU92	0.217	0.137	1.723E-1	372	0.137	0.075	Q9LU92.pdb.gz	TGT4_ARATH Trihelix transcription factor GT-4 OS=Arabidopsis thaliana OX=3702 GN=GT-4 PE=2 SV=1
9	AFDB:O22210	0.211	0.182	1.832E-1	248	0.103	0.085	O22210.pdb.gz	MYBC1_ARATH Transcription factor MYBC1 OS=Arabidopsis thaliana OX=3702 GN=MYBC1 PE=1 SV=1
10	AFDB:Q8H0W3	0.217	0.148	2.645E-1	331	0.152	0.094	Q8H0W3.pdb.gz	RVE6_ARATH Protein REVEILLE 6 OS=Arabidopsis thaliana OX=3702 GN=RVE6 PE=2 SV=1
11	PDB:2cjjA	0.220	0.619	2.577	63	0.049	0.159	2cjjA.pdb.gz
12	PDB:5v8f4	0.140	0.049	3.293	741	0.059	0.016	5v8f4.pdb.gz	Structural basis of Mcm2-7 replicative helicase loading by ORC-Cdc6 and Cdt1.
13	PDB:7awtE	0.098	0.120	3.293	156	0.034	0.045	7awtE.pdb.gz	Structure of the peripheral arm of a minimalistic respiratory complex I.
14	PDB:5n9jZ	0.129	0.199	3.500	119	0.034	0.059	5n9jZ.pdb.gz
15	PDB:7b93E	0.181	0.173	3.721	215	0.059	0.056	7b93E.pdb.gz	Cork-in-bottle mechanism of inhibitor binding to mammalian complex I.
16	PDB:7ctfA	0.175	0.310	4.206	102	0.054	0.108	7ctfA.pdb.gz	Structural insight into the assembly and conformational activation of human origin recognition complex.
17	PDB:5u8s4	0.164	0.058	4.472	682	0.029	0.009	5u8s4.pdb.gz	Structure of eukaryotic CMG helicase at a replication fork and implications to replisome architecture and origin initiation.
18	PDB:6iczL	0.209	0.102	4.472	454	0.088	0.040	6iczL.pdb.gz	Structures of the human spliceosomes before and after release of the ligated exon.
19	PDB:1npdB	0.136	0.100	4.754	288	0.015	0.010	1npdB.pdb.gz	The 2.3-A crystal structure of the shikimate 5-dehydrogenase orthologue YdiB from Escherichia coli suggests a novel catalytic environment for an NAD-dependent dehydrogenase
20	PDB:1s56B	0.123	0.172	4.754	135	0.039	0.059	1s56B.pdb.gz	Heme-ligand tunneling in group I truncated hemoglobins

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9NV56	1.73e-151	420	204	1.000	1.000	MRGBP_HUMAN MRG/MORF4L-binding protein OS=Homo sapiens OX=9606 GN=MRGBP PE=1 SV=1
2	Q7K003	1.41e-30	113	201	0.358	0.363	Q7K003_DROME MRG/MORF4L binding protein OS=Drosophila melanogaster OX=7227 GN=MrgBP PE=1 SV=1
3	P53911	4.37e-06	48.5	425	0.123	0.059	EAF7_YEAST Chromatin modification-related protein EAF7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=EAF7 PE=1 SV=1
4	O42924	2.65e-04	43.1	272	0.098	0.074	EAF7_SCHPO Probable chromatin modification-related protein eaf7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=eaf7 PE=1 SV=1
5	Q12019	0.072	36.2	4910	0.152	0.006	MDN1_YEAST Midasin OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MDN1 PE=1 SV=1
6	Q5A6Q7	0.12	35.4	445	0.088	0.040	EAF7_CANAL Chromatin modification-related protein EAF7 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=EAF7 PE=3 SV=1
7	Q4GYD0	0.42	33.9	1484	0.167	0.023	Q4GYD0_TRYB2 Minichromosome loss protein Mcl1 middle region domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.4480 PE=4 SV=1
8	F5H2T0	0.59	33.5	983	0.093	0.019	F5H2T0_HUMAN IkappaB kinase complex-associated protein OS=Homo sapiens OX=9606 GN=ELP1 PE=1 SV=1
9	O95163	0.66	33.1	1332	0.093	0.014	ELP1_HUMAN Elongator complex protein 1 OS=Homo sapiens OX=9606 GN=ELP1 PE=1 SV=3
10	Q4G0P3	4.4	30.8	5121	0.088	0.004	HYDIN_HUMAN Hydrocephalus-inducing protein homolog OS=Homo sapiens OX=9606 GN=HYDIN PE=1 SV=3
11	Q9VUY8	6.2	30.0	1191	0.108	0.018	WASC5_DROME WASH complex subunit homolog 5 OS=Drosophila melanogaster OX=7227 GN=Strump PE=1 SV=1
12	A0A1D8PSW6	7.4	29.6	501	0.088	0.036	A0A1D8PSW6_CANAL Aldehyde dehydrogenase domain-containing protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CAALFM_CR04870CA PE=3 SV=1
13	Q57ZS4	7.5	29.6	368	0.069	0.038	Q57ZS4_TRYB2 Methyltransferase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.1P6.160 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07904 Eaf7	3.3e-09	48.4	Chromatin modification-related protein EAF7

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000359518

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000331310	0.999	Mortality factor 4-like protein 1
2	9606.ENSP00000361363	0.999	DNA methyltransferase 1-associated protein 1
3	9606.ENSP00000394417	0.999	Mortality factor 4-like protein 2
4	9606.ENSP00000352925	0.998	Transformation/transcription domain-associated protein
5	9606.ENSP00000263062	0.997	Enhancer of polycomb homolog 1
6	9606.ENSP00000362166	0.997	Chromatin modification-related protein MEAF6
7	9606.ENSP00000247843	0.995	YEATS domain-containing protein 4
8	9606.ENSP00000340330	0.995	Histone acetyltransferase KAT5
9	9606.ENSP00000346464	0.993	Vacuolar protein sorting-associated protein 72 homolog
10	9606.ENSP00000374213	0.993	E1A-binding protein p400
11	9606.ENSP00000254900	0.992	Bromodomain-containing protein 8
12	9606.ENSP00000320566	0.992	Inhibitor of growth protein 3
13	9606.ENSP00000258484	0.990	Enhancer of polycomb homolog 2
14	9606.ENSP00000318297	0.988	RuvB-like 1
15	9606.ENSP00000473172	0.988	RuvB-like 2
16	9606.ENSP00000397552	0.979	Actin-like protein 6A
17	9606.ENSP00000332194	0.924	Histone H2A type 2-C
18	9606.ENSP00000332790	0.917	Histone H2A type 2-B
19	9606.ENSP00000297012	0.914	Histone H2A type 1-A
20	9606.ENSP00000328484	0.914	Histone H2A type 1-J

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0060255	0.996	regulation of macromolecule metabolic process
GO:0019219	0.996	regulation of nucleobase-containing compound metabolic process
GO:0043967	0.992	histone H4 acetylation
GO:0051052	0.991	regulation of DNA metabolic process
GO:2001022	0.988	positive regulation of response to DNA damage stimulus
GO:0051726	0.984	regulation of cell cycle
GO:0010604	0.983	positive regulation of macromolecule metabolic process
GO:0045935	0.979	positive regulation of nucleobase-containing compound metabolic process
GO:0000018	0.969	regulation of DNA recombination
GO:2000781	0.969	positive regulation of double-strand break repair
GO:0010569	0.961	regulation of double-strand break repair via homologous recombination
GO:0045911	0.960	positive regulation of DNA recombination
GO:0009987	0.680	cellular process
GO:0006355	0.487	regulation of DNA-templated transcription
GO:0043968	0.397	histone H2A acetylation
GO:1905168	0.397	positive regulation of double-strand break repair via homologous recombination

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0035267	0.999	NuA4 histone acetyltransferase complex
GO:0000786	0.997	nucleosome
GO:0005737	0.324	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]