StarFunc result for job id Q9NV64

User Input

>input (488 residues)
MPGGRRGPSRQQLSRSALPSLQTLVGGGCGNGTGLRNRNGSAIGLPVPPITALITPGPVR
HCQIPDLPVDGSLLFEFLFFIYLLVALFIQYINIYKTVWWYPYNHPASCTSLNFHLIDYH
LAAFITVMLARRLVWALISEATKAGAASMIHYMVLISARLVLLTLCGWVLCWTLVNLFRS
HSVLNLLFLGYPFGVYVPLCCFHQDSRAHLLLTDYNYVVQHEAVEESASTVGGLAKSKDF
LSLLLESLKEQFNNATPIPTHSCPLSPDLIRNEVECLKADFNHRIKEVLFNSLFSAYYVA
FLPLCFVKSTQYYDMRWSCEHLIMVWINAFVMLTTQLLPSKYCDLLHKSAAHLGKWQKLE
HGSYSNAPQHIWSENTIWPQGVLVRHSRCLYRAMGPYNVAVPSDVSHARFYFLFHRPLRL
LNLLILIEGSVVFYQLYSLLRSEKWNHTLSMALILFCNYYVLFKLLRDRIVLGRAYSYPL
NSYELKAN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NV64	1.000	1.000	8.367E-71	488	1.000	1.000	Q9NV64.pdb.gz	TM39A_HUMAN Transmembrane protein 39A OS=Homo sapiens OX=9606 GN=TMEM39A PE=1 SV=1
2	AFDB:Q9GZU3	0.839	0.832	1.171E-43	492	0.518	0.514	Q9GZU3.pdb.gz	TM39B_HUMAN Transmembrane protein 39B OS=Homo sapiens OX=9606 GN=TMEM39B PE=1 SV=1
3	AFDB:A0AVG3	0.104	0.100	3.303E-2	514	0.129	0.123	A0AVG3.pdb.gz	A0AVG3_HUMAN t-SNARE domain containing 1 OS=Homo sapiens OX=9606 GN=TSNARE1 PE=1 SV=1
4	AFDB:A0A024R0W3	0.135	0.132	9.542E-2	506	0.143	0.138	A0A024R0W3.pdb.gz
5	AFDB:Q96M89	0.101	0.082	1.660E-1	665	0.123	0.090	Q96M89.pdb.gz	CC138_HUMAN Coiled-coil domain-containing protein 138 OS=Homo sapiens OX=9606 GN=CCDC138 PE=1 SV=1
6	AFDB:A7MBY5	0.170	0.204	3.472E-1	391	0.129	0.161	A7MBY5.pdb.gz	A7MBY5_DANRE Membrane protein MLC1 OS=Danio rerio OX=7955 GN=si:ch211-192n14.1 PE=2 SV=1
7	AFDB:O59725	0.106	0.098	3.988E-1	550	0.129	0.115	O59725.pdb.gz	MIC60_SCHPO MICOS complex subunit mic60 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mic60 PE=3 SV=1
8	AFDB:D3ZMG0	0.134	0.078	4.796E-1	1051	0.098	0.046	D3ZMG0.pdb.gz	D3ZMG0_RAT Serine/threonine-protein kinase OS=Rattus norvegicus OX=10116 GN=Ulk1 PE=1 SV=3
9	AFDB:Q9QY01	0.137	0.077	4.796E-1	1037	0.082	0.039	Q9QY01.pdb.gz	ULK2_MOUSE Serine/threonine-protein kinase ULK2 OS=Mus musculus OX=10090 GN=Ulk2 PE=1 SV=1
10	AFDB:Q38CG8	0.101	0.057	5.022E-1	1083	0.129	0.058	Q38CG8.pdb.gz	Q38CG8_TRYB2 PB1 domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.7490 PE=4 SV=1
11	PDB:5yqgC	0.129	0.218	6.132E-1	237	0.051	0.105	5yqgC.pdb.gz	Structural determinants controlling 14-3-3 recruitment to the endocytic adaptor Numb and dissociation of the Numb/alpha-adaptin complex.
12	PDB:7qsoM	0.114	0.118	6.421E-1	459	0.111	0.118	7qsoM.pdb.gz	Cryo-EM structures define ubiquinone-10 binding to mitochondrial complex I and conformational transitions accompanying Q-site occupancy.
13	PDB:7nyhN	0.131	0.135	1.170	467	0.121	0.126	7nyhN.pdb.gz
14	PDB:2br9A	0.102	0.165	1.343	230	0.064	0.135	2br9A.pdb.gz	Structural Basis for Protein-Protein Interactions in the 14-3-3 Protein Family.
15	PDB:3axjB	0.102	0.187	1.543	240	0.061	0.125	3axjB.pdb.gz
16	PDB:7d10A	0.126	0.133	1.543	446	0.098	0.108	7d10A.pdb.gz
17	PDB:2btpA	0.128	0.201	1.692	248	0.074	0.145	2btpA.pdb.gz	Structural Basis for Protein-Protein Interactions in the 14-3-3 Protein Family.
18	PDB:7nnlB	0.107	0.083	1.772	682	0.051	0.037	7nnlB.pdb.gz	Deciphering ion transport and ATPase coupling in the intersubunit tunnel of KdpFABC.
19	PDB:3axyC	0.126	0.214	1.855	235	0.061	0.128	3axyC.pdb.gz	14-3-3 proteins act as intracellular receptors for rice Hd3a florigen
20	PDB:7cxrA	0.130	0.184	2.131	307	0.090	0.143	7cxrA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9NV64	0.0	1002	488	1.000	1.000	TM39A_HUMAN Transmembrane protein 39A OS=Homo sapiens OX=9606 GN=TMEM39A PE=1 SV=1
2	Q9GZU3	2.10e-152	445	492	0.518	0.514	TM39B_HUMAN Transmembrane protein 39B OS=Homo sapiens OX=9606 GN=TMEM39B PE=1 SV=1
3	P20871	0.28	36.2	848	0.041	0.024	ENV_HV1JR Envelope glycoprotein gp160 OS=Human immunodeficiency virus type 1 group M subtype B (isolate JRCSF) OX=11688 GN=env PE=1 SV=1
4	Q6ZW76	1.4	33.9	656	0.053	0.040	ANKS3_HUMAN Ankyrin repeat and SAM domain-containing protein 3 OS=Homo sapiens OX=9606 GN=ANKS3 PE=1 SV=1
5	O23141	5.4	32.0	711	0.023	0.015	SPE2_ARATH Arginine decarboxylase 2 OS=Arabidopsis thaliana OX=3702 GN=ADC2 PE=1 SV=1
6	Q75760	5.8	32.0	847	0.039	0.022	Q75760_9HIV1 Envelope glycoprotein gp160 OS=Human immunodeficiency virus 1 OX=11676 GN=env PE=1 SV=1
7	P50876	8.5	31.2	292	0.037	0.062	R144A_HUMAN E3 ubiquitin-protein ligase RNF144A OS=Homo sapiens OX=9606 GN=RNF144A PE=1 SV=2
8	H7C3G0	8.7	31.2	264	0.037	0.068	H7C3G0_HUMAN RBR-type E3 ubiquitin transferase (Fragment) OS=Homo sapiens OX=9606 GN=RNF144A PE=1 SV=1
9	Q8C1F4	9.0	31.2	542	0.035	0.031	CGAT2_MOUSE Chondroitin sulfate N-acetylgalactosaminyltransferase 2 OS=Mus musculus OX=10090 GN=Csgalnact2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10271 Tmp39	2.2e-194	658.0	Putative transmembrane protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000326063

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000387122	0.807	Protein CLEC16A
2	9606.ENSP00000411831	0.741	Kinesin-like protein KIF21B
3	9606.ENSP00000315635	0.687	In neurons, modulates the degradation of NMDA receptor GRIN2B subunit. Plays a role in the regulation of neuronal excitability.
4	9606.ENSP00000264245	0.659	Rho GTPase-activating protein 31
5	9606.ENSP00000361857	0.617	Zinc finger protein Rlf
6	9606.ENSP00000308548	0.576	Zinc finger HIT-type containing 2
7	9606.ENSP00000321320	0.576	Protein HGH1 homolog
8	9606.ENSP00000322180	0.576	Sister chromatid cohesion protein DCC1
9	9606.ENSP00000311984	0.570	ATP-dependent (S)-NAD(P)H-hydrate dehydratase
10	9606.ENSP00000271526	0.559	Proline-rich protein PRCC
11	9606.ENSP00000438349	0.558	Multifunctional methyltransferase subunit TRM112-like protein
12	9606.ENSP00000266069	0.556	Glucose-induced degradation protein 8 homolog
13	9606.ENSP00000268802	0.556	RNA-binding protein NOB1
14	9606.ENSP00000312663	0.555	Neuronal acetylcholine receptor subunit alpha-9
15	9606.ENSP00000230461	0.549	Cell cycle control protein 50A
16	9606.ENSP00000270502	0.546	Mitochondrial import inner membrane translocase subunit Tim29
17	9606.ENSP00000418803	0.518	Complex I assembly factor TIMMDC1, mitochondrial
18	9606.ENSP00000450842	0.512	Cell cycle control protein 50B
19	9606.ENSP00000325381	0.504	Olfactory receptor 8D4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.987	regulation of cellular process
GO:0048518	0.978	positive regulation of biological process
GO:0031323	0.956	regulation of cellular metabolic process
GO:0048519	0.862	negative regulation of biological process
GO:0048523	0.852	negative regulation of cellular process
GO:0051128	0.844	regulation of cellular component organization
GO:0051129	0.736	negative regulation of cellular component organization
GO:0009894	0.735	regulation of catabolic process
GO:1902116	0.726	negative regulation of organelle assembly
GO:0010506	0.719	regulation of autophagy
GO:0009987	0.716	cellular process
GO:0050792	0.689	regulation of viral process
GO:0045069	0.683	regulation of viral genome replication
GO:0044088	0.683	regulation of vacuole organization
GO:0016242	0.682	negative regulation of macroautophagy
GO:0043244	0.681	regulation of protein-containing complex disassembly
GO:0043242	0.601	negative regulation of protein-containing complex disassembly
GO:0048524	0.579	positive regulation of viral process
GO:2000785	0.563	regulation of autophagosome assembly

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005789	0.999	endoplasmic reticulum membrane
GO:0071944	0.448	cell periphery
GO:0005886	0.438	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]