StarFunc result for job id Q9NV66

User Input

>input (732 residues)
MDPSADTWDLFSPLISLWINRFYIYLGFAVSISLWICVQIVIKTQGKNLQEKSVPKAAQD
LMTNGYVSLQEKDIFVSGVKIFYGSQTGTAKGFATVLAEAVTSLDLPVAIINLKEYDPDD
HLIEEVTSKNVCVFLVATYTDGLPTESAEWFCKWLEEASIDFRFGKTYLKGMRYAVFGLG
NSAYASHFNKVGKNVDKWLWMLGAHRVMSRGEGDCDVVKSKHGSIEADFRAWKTKFISQL
QALQKGERKKSCGGHCKKGKCESHQHGSEEREEGSHEQDELHHRDTEEEEPFESSSEEEF
GGEDHQSLNSIVDVEDLGKIMDHVKKEKREKEQQEEKSGLFRNMGRNEDGERRAMITPAL
REALTKQGYQLIGSHSGVKLCRWTKSMLRGRGGCYKHTFYGIESHRCMETTPSLACANKC
VFCWRHHTNPVGTEWRWKMDQPEMILKEAIENHQNMIKQFKGVPGVKAERFEEGMTVKHC
ALSLVGEPIMYPEINRFLKLLHQCKISSFLVTNAQFPAEIRNLEPVTQLYVSVDASTKDS
LKKIDRPLFKDFWQRFLDSLKALAVKQQRTVYRLTLVKAWNVDELQAYAQLVSLGNPDFI
EVKGVTYCGESSASSLTMAHVPWHEEVVQFVHELVDLIPEYEIACEHEHSNCLLIAHRKF
KIGGEWWTWIDYNRFQELIQEYEDSGGSKTFSAKDYMARTPHWALFGASERGFDPKDTRH
QRKNKSKAISGC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6NUM6	0.502	0.548	0.000	668	0.867	0.951	Q6NUM6.pdb.gz	TYW1B_HUMAN S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase TYW1B OS=Homo sapiens OX=9606 GN=TYW1B PE=1 SV=4
2	AFDB:Q8RXN5	0.558	0.617	3.900E-80	647	0.444	0.502	Q8RXN5.pdb.gz	TYW1_ARATH S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase OS=Arabidopsis thaliana OX=3702 GN=TYW1 PE=2 SV=1
3	AFDB:Q57XT3	0.517	0.454	4.387E-69	835	0.413	0.362	Q57XT3.pdb.gz	Q57XT3_TRYB2 tRNA 4-demethylwyosine synthase (AdoMet-dependent) OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.21H15.230 PE=3 SV=1
4	AFDB:O59761	0.504	0.536	7.546E-65	688	0.393	0.419	O59761.pdb.gz	TYW1_SCHPO S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tyw1 PE=3 SV=1
5	AFDB:Q08960	0.498	0.450	1.549E-62	810	0.363	0.328	Q08960.pdb.gz	TYW1_YEAST S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TYW1 PE=1 SV=1
6	AFDB:Q38F53	0.494	0.908	6.571E-47	395	0.245	0.453	Q38F53.pdb.gz	Q38F53_TRYB2 Radical SAM domain protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.3520 PE=4 SV=1
7	AFDB:Q653S9	0.211	0.216	2.449E-15	714	0.183	0.188	Q653S9.pdb.gz	NCPR3_ORYSJ NADPH--cytochrome P450 reductase 3 OS=Oryza sativa subsp. japonica OX=39947 GN=CPR3 PE=1 SV=1
8	AFDB:Q9SUM3	0.210	0.215	2.884E-14	711	0.105	0.108	Q9SUM3.pdb.gz	NCPR2_ARATH NADPH--cytochrome P450 reductase 2 OS=Arabidopsis thaliana OX=3702 GN=ATR2 PE=1 SV=1
9	AFDB:Q0J705	0.208	0.212	1.047E-13	719	0.105	0.107	Q0J705.pdb.gz	NCPR2_ORYSJ NADPH--cytochrome P450 reductase 2 OS=Oryza sativa subsp. japonica OX=39947 GN=CPR2 PE=1 SV=2
10	AFDB:Q384I1	0.202	0.232	2.294E-13	635	0.087	0.101	Q384I1.pdb.gz	Q384I1_TRYB2 NADPH--cytochrome P450 reductase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.0170 PE=4 SV=1
11	PDB:5gxuA	0.205	0.271	4.500E-12	552	0.092	0.121	5gxuA.pdb.gz	Structure of the Arabidopsis thaliana NADPH-cytochrome P450 reductase 2 (ATR2) provides insight into its function
12	PDB:6j79A	0.192	0.172	1.728E-11	816	0.083	0.075	6j79A.pdb.gz	Crystal structure of a NADPH-cytochrome P450 oxidoreductase (CYPOR) and heme oxygenase 1 fusion protein implies a conformational change in CYPOR upon NADPH/NADP+binding.
13	PDB:4oxxA	0.186	0.803	1.288E-8	153	0.055	0.261	4oxxA.pdb.gz	Crystal structure of cindoxin, the P450cin redox partner.
14	PDB:2m6sA	0.189	0.845	3.157E-8	149	0.041	0.201	2m6sA.pdb.gz	1H, 13C and 15N resonance assignments of the apo and holo states of flavodoxin YqcA from Escherichia coli.
15	PDB:2bf4A	0.199	0.226	3.531E-8	645	0.064	0.073	2bf4A.pdb.gz	A Second Fmn-Binding Site in Yeast Nadph-Cytochrome P450 Reductase Suggests a Mechanism of Electron Transfer by Diflavin Reductases.
16	PDB:3c8fA	0.229	0.620	9.115E-7	245	0.053	0.159	3c8fA.pdb.gz	Structural basis for glycyl radical formation by pyruvate formate-lyase activating enzyme.
17	PDB:2mt9A	0.172	0.656	2.644E-6	173	0.042	0.179	2mt9A.pdb.gz	Long-chain flavodoxin FldB from Escherichia coli
18	PDB:5hr7A	0.235	0.443	1.270E-5	360	0.048	0.097	5hr7A.pdb.gz	Crystallographic capture of a radical S-adenosylmethionine enzyme in the act of modifying tRNA.
19	PDB:2mokA	0.181	0.662	1.880E-5	176	0.044	0.182	2mokA.pdb.gz	NMR study of YqcA from Escherichia coli
20	PDB:3esxB	0.175	0.666	3.293E-5	169	0.044	0.189	3esxB.pdb.gz	Flavodoxin: A compromise between efficiency and versatility in the electron transfer from Photosystem I to Ferredoxin-NADP(+) reductase

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6NUM6	0.0	1223	668	0.870	0.954	TYW1B_HUMAN S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase TYW1B OS=Homo sapiens OX=9606 GN=TYW1B PE=1 SV=4
2	Q8RXN5	0.0	610	647	0.433	0.490	TYW1_ARATH S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase OS=Arabidopsis thaliana OX=3702 GN=TYW1 PE=2 SV=1
3	Q57XT3	1.98e-158	481	835	0.321	0.281	Q57XT3_TRYB2 tRNA 4-demethylwyosine synthase (AdoMet-dependent) OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.21H15.230 PE=3 SV=1
4	Q08960	3.14e-155	472	810	0.387	0.349	TYW1_YEAST S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TYW1 PE=1 SV=1
5	O59761	5.10e-153	462	688	0.310	0.330	TYW1_SCHPO S-adenosyl-L-methionine-dependent tRNA 4-demethylwyosine synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=tyw1 PE=3 SV=1
6	Q38F53	3.14e-122	373	395	0.247	0.458	Q38F53_TRYB2 Radical SAM domain protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.3520 PE=4 SV=1
7	Q653S9	4.35e-25	113	714	0.104	0.106	NCPR3_ORYSJ NADPH--cytochrome P450 reductase 3 OS=Oryza sativa subsp. japonica OX=39947 GN=CPR3 PE=1 SV=1
8	E1AVU6	1.40e-24	111	676	0.092	0.099	E1AVU6_CHICK NADPH--cytochrome P450 reductase OS=Gallus gallus OX=9031 GN=POR PE=2 SV=1
9	Q0J705	6.04e-24	109	719	0.100	0.102	NCPR2_ORYSJ NADPH--cytochrome P450 reductase 2 OS=Oryza sativa subsp. japonica OX=39947 GN=CPR2 PE=1 SV=2
10	P00388	1.06e-23	108	678	0.086	0.093	NCPR_RAT NADPH--cytochrome P450 reductase OS=Rattus norvegicus OX=10116 GN=Por PE=1 SV=3
11	P37040	1.07e-23	108	678	0.086	0.093	NCPR_MOUSE NADPH--cytochrome P450 reductase OS=Mus musculus OX=10090 GN=Por PE=1 SV=2
12	P16435	3.03e-23	107	677	0.086	0.093	NCPR_HUMAN NADPH--cytochrome P450 reductase OS=Homo sapiens OX=9606 GN=POR PE=1 SV=2
13	A0A2U1LIM9	4.48e-23	107	704	0.119	0.124	NCPR1_ARTAN NADPH--cytochrome P450 reductase 1 OS=Artemisia annua OX=35608 GN=CPR1 PE=1 SV=2
14	P36587	1.11e-21	102	678	0.096	0.103	NCPR_SCHPO NADPH--cytochrome P450 reductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ccr1 PE=2 SV=1
15	Q27597	1.23e-21	102	679	0.086	0.093	NCPR_DROME NADPH--cytochrome P450 reductase OS=Drosophila melanogaster OX=7227 GN=Cpr PE=1 SV=2
16	Q9SB48	7.60e-21	100	692	0.104	0.110	NCPR1_ARATH NADPH--cytochrome P450 reductase 1 OS=Arabidopsis thaliana OX=3702 GN=ATR1 PE=1 SV=1
17	Q00141	5.29e-19	94.0	694	0.078	0.082	NCPR_ASPNG NADPH--cytochrome P450 reductase OS=Aspergillus niger OX=5061 GN=cprA PE=1 SV=2
18	Q7X7K8	5.59e-19	94.0	695	0.094	0.099	NCPR1_ORYSJ NADPH--cytochrome P450 reductase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=CPR1 PE=1 SV=2
19	Q9SUM3	6.21e-19	94.0	711	0.093	0.096	NCPR2_ARATH NADPH--cytochrome P450 reductase 2 OS=Arabidopsis thaliana OX=3702 GN=ATR2 PE=1 SV=1
20	Q09590	3.78e-18	91.3	662	0.078	0.086	Q09590_CAEEL NADPH--cytochrome P450 reductase OS=Caenorhabditis elegans OX=6239 GN=emb-8 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11684 DUF3280	2.8e+02	13.2	Protein of unknown function (DUF2380)
2	PF00258 Flavodoxin_1	7.5e-23	92.8	Flavodoxin
3	PF04055 Radical_SAM	2.3e-26	104.7	Radical SAM superfamily
4	PF08608 Wyosine_form	2.1e-23	93.8	Wyosine base formation

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000352645

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000359904	0.946	tRNA wybutosine-synthesizing protein 3 homolog
2	9606.ENSP00000307214	0.921	tRNA wybutosine-synthesizing protein 4
3	9606.ENSP00000261249	0.917	tRNA (guanine(37)-N1)-methyltransferase
4	9606.ENSP00000329858	0.915	tRNA wybutosine-synthesizing protein 2 homolog
5	9606.ENSP00000346627	0.802	tRNA wybutosine-synthesizing protein 5
6	9606.ENSP00000455106	0.703	Ribosome biogenesis protein BOP1
7	9606.ENSP00000412698	0.699	MMS19 nucleotide excision repair protein homolog
8	9606.ENSP00000357633	0.657	Glutaredoxin-3
9	9606.ENSP00000217372	0.652	CDK5 regulatory subunit-associated protein 1
10	9606.ENSP00000483495	0.650	Probable ATP-dependent RNA helicase DDX27
11	9606.ENSP00000228347	0.649	DNA-directed RNA polymerase III subunit RPC2
12	9606.ENSP00000380982	0.637	Pumilio homolog 3
13	9606.ENSP00000419004	0.626	60S ribosomal export protein NMD3
14	9606.ENSP00000274695	0.623	Threonylcarbamoyladenosine tRNA methylthiotransferase
15	9606.ENSP00000387365	0.598	Periodic tryptophan protein 1 homolog
16	9606.ENSP00000363642	0.591	Ribosome biogenesis protein BMS1 homolog
17	9606.ENSP00000332448	0.576	Probable inactive tRNA-specific adenosine deaminase-like protein 3
18	9606.ENSP00000326948	0.558	Putative tRNA (cytidine(32)/guanosine(34)-2'-O)-methyltransferase
19	9606.ENSP00000261708	0.553	U3 small nucleolar RNA-associated protein 6 homolog
20	9606.ENSP00000230050	0.541	Ribosomal protein S12

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.991	catalytic activity
GO:0016491	0.583	oxidoreductase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.993	organic substance metabolic process
GO:0044238	0.978	primary metabolic process
GO:0044237	0.975	cellular metabolic process
GO:0006807	0.960	nitrogen compound metabolic process
GO:0065007	0.942	biological regulation
GO:0043170	0.887	macromolecule metabolic process
GO:0050789	0.740	regulation of biological process
GO:0043412	0.703	macromolecule modification
GO:0046483	0.485	heterocycle metabolic process
GO:0006725	0.472	cellular aromatic compound metabolic process
GO:1901360	0.453	organic cyclic compound metabolic process
GO:1901564	0.431	organonitrogen compound metabolic process
GO:0019222	0.424	regulation of metabolic process
GO:0034641	0.419	cellular nitrogen compound metabolic process
GO:0010467	0.379	gene expression
GO:0006139	0.373	nucleobase-containing compound metabolic process
GO:0090304	0.364	nucleic acid metabolic process
GO:0060255	0.334	regulation of macromolecule metabolic process
GO:0034660	0.311	ncRNA metabolic process
GO:0009451	0.304	RNA modification

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0012505	0.795	endomembrane system
GO:0005783	0.781	endoplasmic reticulum
GO:0005739	0.761	mitochondrion
GO:0070013	0.466	intracellular organelle lumen
GO:0031981	0.417	nuclear lumen
GO:0005654	0.398	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:1.-.-.-	0.583	Oxidoreductases.

[back to server]