StarFunc result for job id Q9NV92

User Input

>input (336 residues)
MARRRSQRVCASGPSMLNSARGAPELLRGTATNAEVSAAAAGATGSEELPPGDRGCRNGG
GRGPAATTSSTGVAVGAEHGEDSLSRKPDPEPGRMDHHQPGTGRYQVLLNEEDNSESSAI
EQPPTSNPAPQIVQAASSAPALETDSSPPPYSSITVEVPTTSDTEVYGEFYPVPPPYSVA
TSLPTYDEAEKAKAAAMAAAAAETSQRIQEEECPPRDDFSDADQLRVGNDGIFMLAFFMA
FIFNWLGFCLSFCITNTIAGRYGAICGFGLSLIKWILIVRFSDYFTGYFNGQYWLWWIFL
VLGLLLFFRGFVNYLKVRNMSESMAAAHRTRYFFLL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NV92	1.000	1.000	2.498E-44	336	1.000	1.000	Q9NV92.pdb.gz	NFIP2_HUMAN NEDD4 family-interacting protein 2 OS=Homo sapiens OX=9606 GN=NDFIP2 PE=1 SV=2
2	AFDB:O76447	0.178	0.047	9.847E-1	1475	0.158	0.036	O76447.pdb.gz	O76447_CAEEL HoloCentric chromosome binding Protein OS=Caenorhabditis elegans OX=6239 GN=hcp-1 PE=1 SV=1
3	PDB:7tuzR	0.154	0.175	1.204	284	0.057	0.067	7tuzR.pdb.gz	Structures of oxysterol sensor EBI2/GPR183, a key regulator of the immune response.
4	AFDB:Q54RN4	0.123	0.089	1.240	532	0.113	0.071	Q54RN4.pdb.gz	Q54RN4_DICDI Uncharacterized protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0283015 PE=4 SV=1
5	PDB:4ntaA	0.085	0.168	1.431	147	0.054	0.122	4ntaA.pdb.gz
6	PDB:7wffE	0.165	0.492	1.606	89	0.030	0.112	7wffE.pdb.gz	Supramolecular assembly of chloroplast NADH dehydrogenase-like complex with photosystem I from Arabidopsis thaliana.
7	AFDB:Q22257	0.161	0.047	1.656	1295	0.122	0.032	Q22257.pdb.gz	Q22257_CAEEL HoloCentric chromosome binding Protein OS=Caenorhabditis elegans OX=6239 GN=hcp-2 PE=1 SV=1
8	AFDB:Q54LJ3	0.131	0.094	1.656	478	0.137	0.096	Q54LJ3.pdb.gz	TS101_DICDI ESCRT-I complex subunit tsg101 OS=Dictyostelium discoideum OX=44689 GN=tsg101 PE=3 SV=1
9	AFDB:Q7Z992	0.136	0.098	1.969	487	0.119	0.082	Q7Z992.pdb.gz	SST6_SCHPO ESCRT-I complex subunit vps23 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sst6 PE=3 SV=2
10	PDB:7o4i1	0.151	0.102	2.406	522	0.062	0.040	7o4i1.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.
11	AFDB:Q9VUX7	0.088	0.080	2.783	377	0.119	0.106	Q9VUX7.pdb.gz	Q9VUX7_DROME GH16214p OS=Drosophila melanogaster OX=7227 GN=Mbs PE=1 SV=1
12	PDB:6nd1E	0.132	0.263	3.031	139	0.065	0.158	6nd1E.pdb.gz
13	AFDB:Q60664	0.129	0.085	3.124	539	0.131	0.082	Q60664.pdb.gz	IRAG2_MOUSE Inositol 1,4,5-triphosphate receptor associated 2 OS=Mus musculus OX=10090 GN=Irag2 PE=1 SV=1
14	AFDB:Q66IE4	0.116	0.101	3.310	413	0.152	0.123	Q66IE4.pdb.gz	T237B_DANRE Transmembrane protein 237B OS=Danio rerio OX=7955 GN=tmem237b PE=2 SV=1
15	AFDB:G3V5I6	0.094	0.081	3.506	420	0.104	0.083	G3V5I6.pdb.gz	G3V5I6_HUMAN Zinc finger CCCH domain-containing protein 14 OS=Homo sapiens OX=9606 GN=ZC3H14 PE=1 SV=1
16	PDB:6s7oH	0.117	0.280	3.818	108	0.027	0.083	6s7oH.pdb.gz	Cryo-electron microscopy structures of human oligosaccharyltransferase complexes OST-A and OST-B.
17	PDB:7durR	0.127	0.117	3.818	371	0.042	0.038	7durR.pdb.gz	Molecular insights into ago-allosteric modulation of the human glucagon-like peptide-1 receptor.
18	PDB:4jrzA	0.110	0.212	4.285	155	0.045	0.097	4jrzA.pdb.gz	Crystal Structures of Leukotriene C4 Synthase in Complex with Product Analogs: IMPLICATIONS FOR THE ENZYME MECHANISM.
19	PDB:5oqj1	0.147	0.108	4.285	491	0.065	0.045	5oqj1.pdb.gz	Structures of transcription pre-initiation complex with TFIIH and Mediator.
20	PDB:7cgpA	0.093	0.163	4.540	147	0.039	0.088	7cgpA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9NV92	0.0	692	336	1.000	1.000	NFIP2_HUMAN NEDD4 family-interacting protein 2 OS=Homo sapiens OX=9606 GN=NDFIP2 PE=1 SV=2
2	Q9BT67	1.67e-71	223	221	0.393	0.597	NFIP1_HUMAN NEDD4 family-interacting protein 1 OS=Homo sapiens OX=9606 GN=NDFIP1 PE=1 SV=1
3	Q5U2S1	5.85e-70	219	221	0.390	0.593	NFIP1_RAT NEDD4 family-interacting protein 1 OS=Rattus norvegicus OX=10116 GN=Ndfip1 PE=2 SV=1
4	Q8R0W6	4.08e-69	217	221	0.351	0.534	NFIP1_MOUSE NEDD4 family-interacting protein 1 OS=Mus musculus OX=10090 GN=Ndfip1 PE=1 SV=1
5	Q9VVJ5	5.71e-26	106	267	0.143	0.180	Q9VVJ5_DROME Nedd4 family interacting protein OS=Drosophila melanogaster OX=7227 GN=Ndfip PE=2 SV=1
6	Q9P3T9	0.006	40.4	277	0.057	0.069	BSD2_SCHPO Probable metal homeostasis protein bsd1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=bsd1 PE=3 SV=1
7	O54988	0.026	38.9	1233	0.137	0.037	SLK_MOUSE STE20-like serine/threonine-protein kinase OS=Mus musculus OX=10090 GN=Slk PE=1 SV=2
8	Q95Q95	0.11	37.0	2697	0.054	0.007	TOR_CAEEL Target of rapamycin homolog OS=Caenorhabditis elegans OX=6239 GN=let-363 PE=2 SV=3
9	P38356	0.23	35.4	321	0.068	0.072	BSD2_YEAST Metal homeostatis protein BSD2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BSD2 PE=1 SV=1
10	D0UGE6	0.37	35.4	2819	0.080	0.010	D0UGE6_DROME Tenectin isoform 1 OS=Drosophila melanogaster OX=7227 GN=tnc PE=2 SV=1
11	Q961D7	0.88	33.9	1089	0.137	0.042	Q961D7_DROME LD07765p OS=Drosophila melanogaster OX=7227 GN=ana1 PE=2 SV=1
12	Q9VC64	1.3	33.5	1729	0.137	0.027	Q9VC64_DROME Anastral spindle 1, isoform A OS=Drosophila melanogaster OX=7227 GN=ana1 PE=1 SV=1
13	Q9P2K8	1.9	33.1	1649	0.060	0.012	E2AK4_HUMAN eIF-2-alpha kinase GCN2 OS=Homo sapiens OX=9606 GN=EIF2AK4 PE=1 SV=3
14	Q9W596	4.3	32.0	5495	0.128	0.008	FUTSC_DROME Microtubule-associated protein futsch OS=Drosophila melanogaster OX=7227 GN=futsch PE=1 SV=4
15	Q49AR9	5.8	31.2	570	0.057	0.033	Q49AR9_HUMAN ANKS1A protein OS=Homo sapiens OX=9606 GN=ANKS1A PE=1 SV=1
16	O60393	7.3	31.2	691	0.083	0.041	NOBOX_HUMAN Homeobox protein NOBOX OS=Homo sapiens OX=9606 GN=NOBOX PE=1 SV=4
17	Q726C9	8.2	30.8	612	0.057	0.031	Q726C9_DESVH succinate dehydrogenase OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=fdrA PE=1 SV=1
18	A2ASS6	9.5	30.8	35213	0.092	0.001	TITIN_MOUSE Titin OS=Mus musculus OX=10090 GN=Ttn PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10176 DUF2370	0.0005	31.4	Protein of unknown function (DUF2370)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000480798

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000424827	0.972	E3 ubiquitin-protein ligase NEDD4
2	9606.ENSP00000383199	0.861	E3 ubiquitin-protein ligase NEDD4-like
3	9606.ENSP00000352069	0.837	NEDD4-like E3 ubiquitin-protein ligase WWP2
4	9606.ENSP00000480499	0.770	E3 ubiquitin-protein ligase Itchy homolog
5	9606.ENSP00000257836	0.700	Transmembrane gamma-carboxyglutamic acid protein 4
6	9606.ENSP00000411099	0.682	Serine/threonine-protein kinase tousled-like 1
7	9606.ENSP00000378364	0.575	Natural resistance-associated macrophage protein 2
8	9606.ENSP00000389787	0.558	Pleckstrin homology domain-containing family F member 1
9	9606.ENSP00000161006	0.537	Brain-specific serine protease 4
10	9606.ENSP00000262435	0.531	E3 ubiquitin-protein ligase SMURF2
11	9606.ENSP00000292782	0.527	DCN1-like protein 1
12	9606.ENSP00000427793	0.521	NEDD4-like E3 ubiquitin-protein ligase WWP1
13	9606.ENSP00000262384	0.516	NEDD4-binding protein 1
14	9606.ENSP00000379330	0.507	Nuclear factor of activated T-cells, cytoplasmic 2
15	9606.ENSP00000266022	0.504	RNA-binding protein 6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0050699	1.000	WW domain binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.985	regulation of cellular process
GO:0051173	0.969	positive regulation of nitrogen compound metabolic process
GO:0010604	0.968	positive regulation of macromolecule metabolic process
GO:0060341	0.963	regulation of cellular localization
GO:0031399	0.955	regulation of protein modification process
GO:0009892	0.953	negative regulation of metabolic process
GO:0051247	0.953	positive regulation of protein metabolic process
GO:0023051	0.947	regulation of signaling
GO:0010646	0.945	regulation of cell communication
GO:0048522	0.945	positive regulation of cellular process
GO:0009966	0.944	regulation of signal transduction
GO:0065009	0.943	regulation of molecular function
GO:1903320	0.936	regulation of protein modification by small protein conjugation or removal
GO:0032880	0.935	regulation of protein localization
GO:0048523	0.934	negative regulation of cellular process
GO:0032409	0.926	regulation of transporter activity
GO:0051049	0.920	regulation of transport
GO:0031396	0.920	regulation of protein ubiquitination
GO:0009967	0.917	positive regulation of signal transduction
GO:1903322	0.917	positive regulation of protein modification by small protein conjugation or removal
GO:1903828	0.914	negative regulation of protein localization
GO:0044092	0.908	negative regulation of molecular function
GO:1902533	0.887	positive regulation of intracellular signal transduction
GO:0043123	0.877	positive regulation of I-kappaB kinase/NF-kappaB signaling
GO:0010605	0.875	negative regulation of macromolecule metabolic process
GO:0031398	0.862	positive regulation of protein ubiquitination
GO:0010468	0.861	regulation of gene expression
GO:0051051	0.757	negative regulation of transport
GO:0070201	0.696	regulation of establishment of protein localization
GO:0009987	0.674	cellular process
GO:0051223	0.481	regulation of protein transport
GO:1904950	0.470	negative regulation of establishment of protein localization
GO:0032410	0.458	negative regulation of transporter activity
GO:0051179	0.428	localization
GO:0006810	0.414	transport
GO:0008152	0.405	metabolic process
GO:0071704	0.402	organic substance metabolic process
GO:0010629	0.390	negative regulation of gene expression
GO:0051224	0.372	negative regulation of protein transport
GO:0050896	0.356	response to stimulus
GO:0044238	0.304	primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	1.000	endomembrane system
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0048471	0.991	perinuclear region of cytoplasm
GO:0005794	0.990	Golgi apparatus
GO:0005739	0.967	mitochondrion
GO:0005829	0.924	cytosol
GO:0016020	0.917	membrane
GO:0005783	0.912	endoplasmic reticulum
GO:0005634	0.881	nucleus
GO:0070013	0.821	intracellular organelle lumen
GO:0071944	0.646	cell periphery
GO:0031981	0.543	nuclear lumen
GO:0005654	0.506	nucleoplasm
GO:0005886	0.497	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]