StarFunc result for job id Q9NV96

User Input

>input (361 residues)
MAMNYNAKDEVDGGPPCAPGGTAKTRRPDNTAFKQQRLPAWQPILTAGTVLPIFFIIGLI
FIPIGIGIFVTSNNIREIEIDYTGTEPSSPCNKCLSPDVTPCFCTINFTLEKSFEGNVFM
YYGLSNFYQNHRRYVKSRDDSQLNGDSSALLNPSKECEPYRRNEDKPIAPCGAIANSMFN
DTLELFLIGNDSYPIPIALKKKGIAWWTDKNVKFRNPPGGDNLEERFKGTTKPVNWLKPV
YMLDSDPDNNGFINEDFIVWMRTAALPTFRKLYRLIERKSDLHPTLPAGRYSLNVTYNYP
VHYFDGRKRMILSTISWMGGKNPFLGIAYIAVGSISFLLGVVLLVINHKYRNSSNTADIT
I

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NV96	1.000	1.000	1.020E-77	361	1.000	1.000	Q9NV96.pdb.gz	CC50A_HUMAN Cell cycle control protein 50A OS=Homo sapiens OX=9606 GN=TMEM30A PE=1 SV=1
2	AFDB:Q8VEK0	0.961	0.954	2.912E-70	364	0.892	0.885	Q8VEK0.pdb.gz	CC50A_MOUSE Cell cycle control protein 50A OS=Mus musculus OX=10090 GN=Tmem30a PE=1 SV=1
3	PDB:7vgiA	0.841	0.915	6.370E-64	331	0.911	0.994	7vgiA.pdb.gz	Structural insights into the activation of autoinhibited human lipid flippase ATP8B1 upon substrate binding.
4	AFDB:Q3MIR4	0.870	0.894	3.044E-48	351	0.501	0.516	Q3MIR4.pdb.gz	CC50B_HUMAN Cell cycle control protein 50B OS=Homo sapiens OX=9606 GN=TMEM30B PE=1 SV=1
5	PDB:7vghA	0.808	0.861	7.654E-45	338	0.493	0.527	7vghA.pdb.gz	Structural insights into the activation of autoinhibited human lipid flippase ATP8B1 upon substrate binding.
6	AFDB:Q19635	0.797	0.797	1.726E-38	361	0.355	0.355	Q19635.pdb.gz	Q19635_CAEEL Cell cycle control protein 50A OS=Caenorhabditis elegans OX=6239 GN=cdc-50.b PE=3 SV=1
7	AFDB:Q1MTQ5	0.711	0.653	1.228E-32	396	0.374	0.341	Q1MTQ5.pdb.gz	MUG89_SCHPO Phospholipid-transporting ATPase accessory subunit mug89 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug89 PE=2 SV=1
8	AFDB:Q9LTW0	0.682	0.702	5.719E-32	350	0.366	0.377	Q9LTW0.pdb.gz	ALIS1_ARATH ALA-interacting subunit 1 OS=Arabidopsis thaliana OX=3702 GN=ALIS1 PE=1 SV=1
9	AFDB:Q9SLK2	0.689	0.711	1.058E-31	349	0.366	0.378	Q9SLK2.pdb.gz	ALIS3_ARATH ALA-interacting subunit 3 OS=Arabidopsis thaliana OX=3702 GN=ALIS3 PE=1 SV=1
10	AFDB:Q8L8W0	0.684	0.704	1.731E-31	350	0.377	0.389	Q8L8W0.pdb.gz	ALIS5_ARATH ALA-interacting subunit 5 OS=Arabidopsis thaliana OX=3702 GN=ALIS5 PE=1 SV=1
11	AFDB:Q96WW4	0.701	0.683	2.082E-31	371	0.349	0.340	Q96WW4.pdb.gz	IVN1_SCHPO Phospholipid-transporting ATPase accessory subunit ivn1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ivn1 PE=3 SV=1
12	AFDB:P25656	0.692	0.642	3.852E-31	391	0.343	0.317	P25656.pdb.gz	CDC50_YEAST Phospholipid-transporting ATPase accessory subunit CDC50 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CDC50 PE=1 SV=1
13	PDB:7oh5C	0.666	0.677	9.348E-29	355	0.338	0.344	7oh5C.pdb.gz	Structural basis of substrate-independent phosphorylation in a P4-ATPase lipid flippase
14	PDB:7kycB	0.678	0.656	4.241E-27	374	0.310	0.299	7kycB.pdb.gz	Transport mechanism of P4 ATPase phosphatidylcholine flippases.
15	PDB:4kncB	0.134	0.119	1.588E-1	419	0.039	0.033	4kncB.pdb.gz
16	PDB:3am2A	0.177	0.212	1.688E-1	286	0.042	0.052	3am2A.pdb.gz
17	PDB:6oj0Z	0.195	0.323	1.688E-1	180	0.075	0.150	6oj0Z.pdb.gz
18	PDB:1kfuL	0.142	0.087	2.297E-1	699	0.075	0.039	1kfuL.pdb.gz
19	PDB:4uybA	0.125	0.115	2.938E-1	401	0.064	0.057	4uybA.pdb.gz
20	PDB:6ds5A	0.175	0.321	2.938E-1	160	0.066	0.150	6ds5A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	G3HH32	0.0	618	363	0.909	0.904	G3HH32_CRIGR Cell cycle control protein OS=Cricetulus griseus OX=10029 GN=Tmem30a PE=3 SV=1
2	Q17QL5	0.0	634	361	0.931	0.931	CC50A_BOVIN Cell cycle control protein 50A OS=Bos taurus OX=9913 GN=TMEM30A PE=1 SV=1
3	Q8VEK0	0.0	604	364	0.892	0.885	CC50A_MOUSE Cell cycle control protein 50A OS=Mus musculus OX=10090 GN=Tmem30a PE=1 SV=1
4	Q9NV96	0.0	746	361	1.000	1.000	CC50A_HUMAN Cell cycle control protein 50A OS=Homo sapiens OX=9606 GN=TMEM30A PE=1 SV=1
5	Q3MIR4	2.46e-124	363	351	0.501	0.516	CC50B_HUMAN Cell cycle control protein 50B OS=Homo sapiens OX=9606 GN=TMEM30B PE=1 SV=1
6	Q19635	2.66e-66	215	361	0.368	0.368	Q19635_CAEEL Cell cycle control protein 50A OS=Caenorhabditis elegans OX=6239 GN=cdc-50.b PE=3 SV=1
7	Q9SLK2	9.22e-66	213	349	0.363	0.375	ALIS3_ARATH ALA-interacting subunit 3 OS=Arabidopsis thaliana OX=3702 GN=ALIS3 PE=1 SV=1
8	Q1MTQ5	3.36e-65	213	396	0.407	0.371	MUG89_SCHPO Phospholipid-transporting ATPase accessory subunit mug89 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug89 PE=2 SV=1
9	P25656	3.59e-64	211	391	0.357	0.330	CDC50_YEAST Phospholipid-transporting ATPase accessory subunit CDC50 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CDC50 PE=1 SV=1
10	Q9LTW0	8.15e-62	203	350	0.366	0.377	ALIS1_ARATH ALA-interacting subunit 1 OS=Arabidopsis thaliana OX=3702 GN=ALIS1 PE=1 SV=1
11	Q8L8W0	5.84e-61	201	350	0.349	0.360	ALIS5_ARATH ALA-interacting subunit 5 OS=Arabidopsis thaliana OX=3702 GN=ALIS5 PE=1 SV=1
12	Q96WW4	7.42e-58	194	371	0.377	0.367	IVN1_SCHPO Phospholipid-transporting ATPase accessory subunit ivn1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ivn1 PE=3 SV=1
13	P53740	6.67e-57	192	393	0.352	0.323	YN8S_YEAST Phospholipid-transporting ATPase accessory subunit CRF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YNR048W PE=1 SV=1
14	Q9SA35	4.17e-56	188	336	0.343	0.369	ALIS4_ARATH Putative ALA-interacting subunit 4 OS=Arabidopsis thaliana OX=3702 GN=ALIS4 PE=2 SV=2
15	P42838	2.27e-44	159	414	0.330	0.287	LEM3_YEAST Phospholipid-transporting ATPase accessory subunit LEM3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=LEM3 PE=1 SV=1
16	Q38DJ5	4.56e-39	145	388	0.343	0.320	Q38DJ5_TRYB2 LEM3 (Ligand-effect modulator 3) family / CDC50 family OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.3110 PE=3 SV=1
17	Q382G0	1.55e-30	121	357	0.274	0.277	Q382G0_TRYB2 LEM3 (Ligand-effect modulator 3) family / CDC50 family OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.5340 PE=3 SV=1
18	S7WII9	5.44e-27	113	524	0.271	0.187	CDC50_TOXGG CDC50-related protein CDC50.1 OS=Toxoplasma gondii (strain ATCC 50853 / GT1) OX=507601 GN=CDC50.1 PE=1 SV=1
19	Q382L6	1.97e-26	111	470	0.294	0.226	Q382L6_TRYB2 LEM3 (Ligand-effect modulator 3) family / CDC50 family OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.4760 PE=3 SV=1
20	A0A1D8PF22	3.0	32.3	437	0.053	0.043	A0A1D8PF22_CANAL Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit WBP1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=WBP1 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03381 CDC50	5.6e-90	313.3	LEM3 (ligand-effect modulator 3) family / CDC50 family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000230461

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000371084	0.998	Phospholipid-transporting ATPase IA
2	9606.ENSP00000445359	0.996	Phospholipid-transporting ATPase IC
3	9606.ENSP00000371070	0.980	Phospholipid-transporting ATPase IB
4	9606.ENSP00000332756	0.973	Phospholipid-transporting ATPase IG
5	9606.ENSP00000357475	0.933	Phospholipid-transporting ATPase ID
6	9606.ENSP00000349325	0.913	Probable phospholipid-transporting ATPase VA
7	9606.ENSP00000284509	0.894	Probable phospholipid-transporting ATPase IM
8	9606.ENSP00000273859	0.886	Probable phospholipid-transporting ATPase VD
9	9606.ENSP00000321195	0.885	Probable phospholipid-transporting ATPase IF
10	9606.ENSP00000420387	0.875	Probable phospholipid-transporting ATPase IH
11	9606.ENSP00000311336	0.874	Phospholipid-transporting ATPase IK
12	9606.ENSP00000313600	0.853	Probable phospholipid-transporting ATPase VB
13	9606.ENSP00000342481	0.804	Probable phospholipid-transporting ATPase IIA
14	9606.ENSP00000398076	0.786	Probable phospholipid-transporting ATPase IIB
15	9606.ENSP00000284981	0.757	Amyloid-beta A4 protein
16	9606.ENSP00000419663	0.710	Cell cycle control protein 50C
17	9606.ENSP00000437188	0.669	T-lymphoma invasion and metastasis-inducing protein 2
18	9606.ENSP00000354652	0.642	Neuropeptide Y receptor type 1
19	9606.ENSP00000356133	0.633	Claudin-20
20	9606.ENSP00000479153	0.626	EH domain-containing protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005548	0.998	phospholipid transporter activity
GO:0140327	0.998	flippase activity
GO:0015247	0.971	aminophospholipid flippase activity
GO:0005198	0.478	structural molecule activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0065007	0.996	biological regulation
GO:0097035	0.992	regulation of membrane lipid distribution
GO:0050794	0.982	regulation of cellular process
GO:0051179	0.965	localization
GO:0034204	0.945	lipid translocation
GO:0045332	0.944	phospholipid translocation
GO:0048518	0.848	positive regulation of biological process
GO:0048522	0.809	positive regulation of cellular process
GO:0051128	0.647	regulation of cellular component organization
GO:0051049	0.366	regulation of transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.996	membrane
GO:0012505	0.996	endomembrane system
GO:0005737	0.996	cytoplasm
GO:0043231	0.996	intracellular membrane-bounded organelle
GO:0032991	0.992	protein-containing complex
GO:1990531	0.979	phospholipid-translocating ATPase complex
GO:0071944	0.977	cell periphery
GO:0031090	0.973	organelle membrane
GO:0005886	0.962	plasma membrane
GO:0030659	0.960	cytoplasmic vesicle membrane
GO:0098588	0.953	bounding membrane of organelle
GO:0005768	0.889	endosome
GO:0005783	0.879	endoplasmic reticulum
GO:0000323	0.826	lytic vacuole
GO:0005764	0.824	lysosome
GO:0099503	0.807	secretory vesicle
GO:0005634	0.804	nucleus
GO:0030141	0.803	secretory granule
GO:0005765	0.761	lysosomal membrane
GO:0030667	0.743	secretory granule membrane
GO:0005766	0.693	primary lysosome
GO:0010008	0.686	endosome membrane
GO:0035579	0.609	specific granule membrane
GO:0031901	0.559	early endosome membrane
GO:0005770	0.551	late endosome
GO:0035577	0.531	azurophil granule membrane
GO:0031902	0.434	late endosome membrane
GO:0005654	0.386	nucleoplasm
GO:0043230	0.350	extracellular organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:7.6.2.1	0.998	P-type phospholipid transporter.

[back to server]