StarFunc result for job id Q9NVC3

User Input

>input (462 residues)
MAQVSINNDYSEWDLSTDAGERARLLQSPCVDTAPKSEWEASPGGLDRGTTSTLGAIFIV
VNACLGAGLLNFPAAFSTAGGVAAGIALQMGMLVFIISGLVILAYCSQASNERTYQEVVW
AVCGKLTGVLCEVAIAVYTFGTCIAFLIIIGDQQDKIIAVMAKEPEGASGPWYTDRKFTI
SLTAFLFILPLSIPREIGFQKYASFLSVVGTWYVTAIVIIKYIWPDKEMTPGNILTRPAS
WMAVFNAMPTICFGFQCHVSSVPVFNSMQQPEVKTWGGVVTAAMVIALAVYMGTGICGFL
TFGAAVDPDVLLSYPSEDMAVAVARAFIILSVLTSYPILHFCGRAVVEGLWLRYQGVPVE
EDVGRERRRRVLQTLVWFLLTLLLALFIPDIGKVISVIGGLAACFIFVFPGLCLIQAKLS
EMEEVKPASWWVLVSYGVLLVTLGAFIFGQTTANAIFVDLLA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8BWH0	0.901	0.900	5.093E-58	463	0.950	0.948	Q8BWH0.pdb.gz	S38A7_MOUSE Sodium-coupled neutral amino acid transporter 7 OS=Mus musculus OX=10090 GN=Slc38a7 PE=1 SV=1
2	AFDB:P39981	0.783	0.755	3.616E-21	480	0.203	0.196	P39981.pdb.gz	AVT2_YEAST Vacuolar amino acid transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=AVT2 PE=2 SV=1
3	AFDB:Q8WUX1	0.772	0.756	5.136E-21	472	0.216	0.212	Q8WUX1.pdb.gz	S38A5_HUMAN Sodium-coupled neutral amino acid transporter 5 OS=Homo sapiens OX=9606 GN=SLC38A5 PE=1 SV=1
4	AFDB:A2VCW5	0.765	0.740	5.859E-21	479	0.219	0.211	A2VCW5.pdb.gz	S38A5_RAT Sodium-coupled neutral amino acid transporter 5 OS=Rattus norvegicus OX=10116 GN=Slc38a5 PE=1 SV=1
5	AFDB:A0A024R0W3	0.749	0.687	2.604E-20	506	0.210	0.192	A0A024R0W3.pdb.gz
6	AFDB:P40074	0.800	0.825	2.721E-20	448	0.201	0.208	P40074.pdb.gz	AVT6_YEAST Vacuolar amino acid transporter 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=AVT6 PE=1 SV=1
7	AFDB:Q8IZM9	0.788	0.798	3.540E-20	456	0.236	0.239	Q8IZM9.pdb.gz	S38A6_HUMAN Solute carrier family 38 member 6 OS=Homo sapiens OX=9606 GN=SLC38A6 PE=1 SV=2
8	AFDB:Q8CFE6	0.789	0.726	6.262E-20	504	0.225	0.206	Q8CFE6.pdb.gz	S38A2_MOUSE Sodium-coupled neutral amino acid symporter 2 OS=Mus musculus OX=10090 GN=Slc38a2 PE=1 SV=1
9	AFDB:G3UVW3	0.787	0.795	9.294E-20	457	0.234	0.236	G3UVW3.pdb.gz	S38A6_MOUSE Solute carrier family 38 member 6 OS=Mus musculus OX=10090 GN=Slc38a6 PE=1 SV=1
10	AFDB:Q9H2H9	0.753	0.716	1.157E-19	487	0.219	0.207	Q9H2H9.pdb.gz	S38A1_HUMAN Sodium-coupled neutral amino acid symporter 1 OS=Homo sapiens OX=9606 GN=SLC38A1 PE=1 SV=1
11	PDB:7kgvB	0.663	0.748	7.700E-10	404	0.145	0.166	7kgvB.pdb.gz
12	PDB:7kgvA	0.537	0.662	5.307E-9	361	0.160	0.205	7kgvA.pdb.gz
13	PDB:7p9uB	0.576	0.583	1.521E-8	455	0.149	0.152	7p9uB.pdb.gz	Molecular basis for redox control by the human cystine/glutamate antiporter system xc .
14	PDB:7dskB	0.610	0.608	4.760E-8	464	0.119	0.119	7dskB.pdb.gz	Mechanism of substrate transport and inhibition of the human LAT1-4F2hc amino acid transporter.
15	PDB:7s1xB	0.548	0.324	4.760E-8	871	0.132	0.070	7s1xB.pdb.gz	Structural basis for inhibition of the Cation-chloride cotransporter NKCC1 by the diuretic drug bumetanide
16	PDB:6li9B	0.586	0.590	2.876E-7	458	0.119	0.120	6li9B.pdb.gz	Cryo-EM structure of the human heteromeric amino acid transporter b0,+AT-rBAT.
17	PDB:7cmhB	0.480	0.483	3.742E-7	458	0.139	0.140	7cmhB.pdb.gz	Structural insight into the substrate recognition and transport mechanism of the human LAT2-4F2hc complex.
18	PDB:6jmqA	0.536	0.598	7.551E-7	403	0.123	0.141	6jmqA.pdb.gz	Cryo-EM structure of the human L-type amino acid transporter 1 in complex with glycoprotein CD98hc.
19	PDB:5j4nA	0.639	0.671	1.278E-6	437	0.132	0.140	5j4nA.pdb.gz	Insights into the molecular basis for substrate binding and specificity of the wild-type L-arginine/agmatine antiporter AdiC.
20	PDB:4djiA	0.488	0.466	7.076E-6	493	0.132	0.124	4djiA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8BWH0	0.0	868	463	0.950	0.948	S38A7_MOUSE Sodium-coupled neutral amino acid transporter 7 OS=Mus musculus OX=10090 GN=Slc38a7 PE=1 SV=1
2	Q9NVC3	0.0	932	462	1.000	1.000	S38A7_HUMAN Sodium-coupled neutral amino acid transporter 7 OS=Homo sapiens OX=9606 GN=SLC38A7 PE=1 SV=1
3	Q8IZM9	2.85e-27	115	456	0.221	0.224	S38A6_HUMAN Solute carrier family 38 member 6 OS=Homo sapiens OX=9606 GN=SLC38A6 PE=1 SV=2
4	G3UVW3	5.17e-26	112	457	0.214	0.217	S38A6_MOUSE Solute carrier family 38 member 6 OS=Mus musculus OX=10090 GN=Slc38a6 PE=1 SV=1
5	P39981	8.36e-24	105	480	0.210	0.202	AVT2_YEAST Vacuolar amino acid transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=AVT2 PE=2 SV=1
6	P40074	2.67e-23	103	448	0.171	0.176	AVT6_YEAST Vacuolar amino acid transporter 6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=AVT6 PE=1 SV=1
7	Q9JM15	6.44e-23	103	485	0.208	0.198	S38A1_RAT Sodium-coupled neutral amino acid symporter 1 OS=Rattus norvegicus OX=10116 GN=Slc38a1 PE=1 SV=1
8	Q9H2H9	1.01e-21	99.8	487	0.206	0.195	S38A1_HUMAN Sodium-coupled neutral amino acid symporter 1 OS=Homo sapiens OX=9606 GN=SLC38A1 PE=1 SV=1
9	Q8K2P7	2.24e-21	98.6	485	0.175	0.167	S38A1_MOUSE Sodium-coupled neutral amino acid symporter 1 OS=Mus musculus OX=10090 GN=Slc38a1 PE=1 SV=1
10	Q57Y06	7.17e-21	97.1	471	0.240	0.236	Q57Y06_TRYB2 Amino acid transporter, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.1D20.560 PE=4 SV=1
11	Q57V86	1.94e-20	95.9	466	0.234	0.232	Q57V86_TRYB2 Amino acid transporter, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.30P3.170 PE=4 SV=1
12	O74327	2.90e-20	94.7	420	0.203	0.224	AVT5_SCHPO Vacuolar amino acid transporter 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=avt5 PE=3 SV=1
13	Q57V81	8.82e-20	94.4	539	0.232	0.199	Q57V81_TRYB2 Amino acid transporter, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.30P3.120 PE=4 SV=1
14	Q381K0	9.38e-20	93.6	462	0.229	0.229	Q381K0_TRYB2 Amino acid transporter, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.7520 PE=4 SV=1
15	Q584L8	3.08e-18	89.0	451	0.240	0.246	Q584L8_TRYB2 Amino acid transporter, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.3M17.60 PE=4 SV=1
16	Q584M0	3.24e-18	89.0	450	0.245	0.251	Q584M0_TRYB2 Amino acid transporter, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.3M17.40 PE=4 SV=1
17	Q57XZ7	5.10e-18	88.6	453	0.206	0.210	Q57XZ7_TRYB2 Amino acid transporter, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.1D20.780 PE=4 SV=1
18	Q9M8L9	6.39e-18	88.2	489	0.212	0.200	AVT6E_ARATH Amino acid transporter AVT6E OS=Arabidopsis thaliana OX=3702 GN=AVT6E PE=2 SV=1
19	Q9JHZ9	1.01e-17	87.8	504	0.206	0.188	S38A3_RAT Sodium-coupled neutral amino acid transporter 3 OS=Rattus norvegicus OX=10116 GN=Slc38a3 PE=1 SV=1
20	Q57V82	2.49e-17	86.3	467	0.227	0.225	Q57V82_TRYB2 Amino acid transporter 1, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.30P3.130 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01490 Aa_trans	8.9e-52	187.8	Transmembrane amino acid transporter protein
2	PF03845 Spore_permease	1	19.7	Spore germination protein
3	PF18895 T4SS_pilin	35	15.9	Type IV secretion system pilin
4	PF03222 Trp_Tyr_perm	2.9e-06	38.2	Tryptophan/tyrosine permease family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000454646

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000301732	0.826	ATP-binding cassette sub-family A member 3
2	9606.ENSP00000356437	0.817	SAM and SH3 domain-containing protein 1
3	9606.ENSP00000360108	0.817	Putative tyrosine-protein phosphatase auxilin
4	9606.ENSP00000371211	0.817	Transmembrane protease serine 6
5	9606.ENSP00000380019	0.817	Zinc finger protein 384
6	9606.ENSP00000385722	0.817	Integrator complex subunit 1
7	9606.ENSP00000482968	0.817	Alstrom syndrome protein 1
8	9606.ENSP00000312250	0.808	ADP-dependent glucokinase
9	9606.ENSP00000361499	0.735	Protein YIPF3
10	9606.ENSP00000379838	0.702	Calcium-regulated heat-stable protein 1
11	9606.ENSP00000253031	0.700	Protein YIPF2
12	9606.ENSP00000438115	0.698	COP9 signalosome complex subunit 7a
13	9606.ENSP00000225573	0.695	Pyridoxine-5'-phosphate oxidase
14	9606.ENSP00000398410	0.684	JmjC domain-containing protein 5
15	9606.ENSP00000243389	0.661	Proton-coupled amino acid transporter 1
16	9606.ENSP00000325674	0.653	Exocyst complex component 3-like protein
17	9606.ENSP00000401018	0.653	GINS complex subunit 3
18	9606.ENSP00000267803	0.650	Dual oxidase maturation factor 1
19	9606.ENSP00000319705	0.650	Dual oxidase maturation factor 2
20	9606.ENSP00000367823	0.636	Protein FAM214B

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0022858	1.000	alanine transmembrane transporter activity
GO:0015186	1.000	L-glutamine transmembrane transporter activity
GO:0005283	1.000	amino acid:sodium symporter activity
GO:0005515	0.717	protein binding
GO:0005295	0.652	neutral L-amino acid:sodium symporter activity
GO:0042887	0.490	amide transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0006810	0.996	transport
GO:0046942	0.988	carboxylic acid transport
GO:0071705	0.979	nitrogen compound transport
GO:0006865	0.971	amino acid transport
GO:0015804	0.932	neutral amino acid transport
GO:0009987	0.364	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043231	0.998	intracellular membrane-bounded organelle
GO:0016020	0.995	membrane
GO:0031090	0.941	organelle membrane
GO:0005886	0.938	plasma membrane
GO:0005773	0.905	vacuole
GO:0098588	0.635	bounding membrane of organelle
GO:0005774	0.615	vacuolar membrane
GO:0000323	0.597	lytic vacuole
GO:0098852	0.476	lytic vacuole membrane
GO:0042995	0.423	cell projection
GO:0120025	0.414	plasma membrane bounded cell projection
GO:0005764	0.405	lysosome
GO:0005765	0.327	lysosomal membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:34963	1.000	Na(+)(in) = Na(+)(out)

[back to server]