StarFunc result for job id Q9NVC6

User Input

>input (651 residues)
MSGVRAVRISIESACEKQVHEVGLDGTETYLPPLSMSQNLARLAQRIDFSQGSGSEEEEA
AGTEGDAQEWPGAGSSADQDDEEGVVKFQPSLWPWDSVRNNLRSALTEMCVLYDVLSIVR
DKKFMTLDPVSQDALPPKQNPQTLQLISKKKSLAGAAQILLKGAERLTKSVTENQENKLQ
RDFNSELLRLRQHWKLRKVGDKILGDLSYRSAGSLFPHHGTFEVIKNTDLDLDKKIPEDY
CPLDVQIPSDLEGSAYIKVSIQKQAPDIGDLGTVNLFKRPLPKSKPGSPHWQTKLEAAQN
VLLCKEIFAQLSREAVQIKSQVPHIVVKNQIISQPFPSLQLSISLCHSSNDKKSQKFATE
KQCPEDHLYVLEHNLHLLIREFHKQTLSSIMMPHPASAPFGHKRMRLSGPQAFDKNEINS
LQSSEGLLEKIIKQAKHIFLRSRAAATIDSLASRIEDPQIQAHWSNINDVYESSVKVLIT
SQGYEQICKSIQLQLNIGVEQIRVVHRDGRVITLSYQEQELQDFLLSQMSQHQVHAVQQL
AKVMGWQVLSFSNHVGLGPIESIGNASAITVASPSGDYAISVRNGPESGSKIMVQFPRNQ
CKDLPKSDVLQDNKWSHLRGPFKEVQWNKMEGRNFVYKMELLMSALSPCLL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NVC6	1.000	1.000	0.000	651	1.000	1.000	Q9NVC6.pdb.gz	MED17_HUMAN Mediator of RNA polymerase II transcription subunit 17 OS=Homo sapiens OX=9606 GN=MED17 PE=1 SV=2
2	PDB:7enaq	0.619	0.719	1.514E-76	555	0.846	0.993	7enaq.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
3	AFDB:Q9VEC1	0.715	0.724	1.559E-61	642	0.425	0.431	Q9VEC1.pdb.gz	MED17_DROME Mediator of RNA polymerase II transcription subunit 17 OS=Drosophila melanogaster OX=7227 GN=MED17 PE=1 SV=1
4	PDB:7nvrd	0.563	0.814	4.888E-53	439	0.662	0.982	7nvrd.pdb.gz	Structures of mammalian RNA polymerase II pre-initiation complexes.
5	PDB:6w1sL	0.559	0.678	2.404E-49	524	0.762	0.947	6w1sL.pdb.gz	A Pliable Mediator Acts as a Functional Rather Than an Architectural Bridge between Promoters and Enhancers.
6	AFDB:P32569	0.322	0.308	6.206E-12	687	0.124	0.118	P32569.pdb.gz	MED17_YEAST Mediator of RNA polymerase II transcription subunit 17 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SRB4 PE=1 SV=1
7	PDB:5u0pQ	0.298	0.365	8.412E-10	508	0.111	0.142	5u0pQ.pdb.gz
8	PDB:5oqmd	0.283	0.380	4.357E-6	442	0.098	0.145	5oqmd.pdb.gz	Structures of transcription pre-initiation complex with TFIIH and Mediator.
9	PDB:4gwqB	0.244	0.305	6.508E-4	492	0.104	0.138	4gwqB.pdb.gz	Structure of the Mediator Head module bound to the carboxy-terminal domain of RNA polymerase II.
10	PDB:7emfN	0.203	0.147	9.301E-3	1017	0.068	0.043	7emfN.pdb.gz	Structures of the human Mediator and Mediator-bound preinitiation complex.
11	PDB:6y2pA	0.073	0.125	1.412E-2	355	0.034	0.062	6y2pA.pdb.gz
12	AFDB:Q8IGZ6	0.083	0.074	3.401E-2	791	0.104	0.086	Q8IGZ6.pdb.gz	Q8IGZ6_DROME LP11180p (Fragment) OS=Drosophila melanogaster OX=7227 GN=Dic61B PE=2 SV=1
13	PDB:6qleP	0.131	0.251	6.080E-2	242	0.035	0.095	6qleP.pdb.gz
14	AFDB:Q56XR0	0.061	0.119	1.129E-1	327	0.065	0.128	Q56XR0.pdb.gz	BH071_ARATH Transcription factor bHLH71 OS=Arabidopsis thaliana OX=3702 GN=BHLH71 PE=1 SV=1
15	PDB:2p4bB	0.066	0.146	1.400E-1	260	0.026	0.065	2p4bB.pdb.gz
16	AFDB:E9QFM9	0.072	0.079	1.465E-1	583	0.057	0.063	E9QFM9.pdb.gz
17	AFDB:O13741	0.060	0.077	2.003E-1	438	0.088	0.130	O13741.pdb.gz	NOP12_SCHPO Nucleolar protein 12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=nop12 PE=1 SV=1
18	AFDB:Q9C8E6	0.068	0.057	2.342E-1	843	0.114	0.088	Q9C8E6.pdb.gz	PMI1_ARATH Protein PLASTID MOVEMENT IMPAIRED 1 OS=Arabidopsis thaliana OX=3702 GN=PMI1 PE=1 SV=1
19	AFDB:O55047	0.078	0.073	2.468E-1	718	0.083	0.075	O55047.pdb.gz	TLK2_MOUSE Serine/threonine-protein kinase tousled-like 2 OS=Mus musculus OX=10090 GN=Tlk2 PE=1 SV=2
20	AFDB:E7F2R5	0.117	0.114	3.040E-1	678	0.094	0.090	E7F2R5.pdb.gz	E7F2R5_DANRE Chromatin licensing and DNA replication factor 1 OS=Danio rerio OX=7955 GN=cdt1 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D4ABU0	0.0	1277	649	0.959	0.961	D4ABU0_RAT Mediator of RNA polymerase II transcription subunit 17 OS=Rattus norvegicus OX=10116 GN=Med17 PE=1 SV=3
2	Q8VCD5	0.0	1276	649	0.957	0.960	MED17_MOUSE Mediator of RNA polymerase II transcription subunit 17 OS=Mus musculus OX=10090 GN=Med17 PE=1 SV=1
3	Q9NVC6	0.0	1341	651	1.000	1.000	MED17_HUMAN Mediator of RNA polymerase II transcription subunit 17 OS=Homo sapiens OX=9606 GN=MED17 PE=1 SV=2
4	Q9VEC1	8.19e-168	496	642	0.427	0.433	MED17_DROME Mediator of RNA polymerase II transcription subunit 17 OS=Drosophila melanogaster OX=7227 GN=MED17 PE=1 SV=1
5	F4K460	1.1	34.7	653	0.045	0.044	MED17_ARATH Mediator of RNA polymerase II transcription subunit 17 OS=Arabidopsis thaliana OX=3702 GN=MED17 PE=1 SV=1
6	Q10751	2.0	34.3	1281	0.038	0.020	ACE_CHICK Angiotensin-converting enzyme OS=Gallus gallus OX=9031 GN=ACE PE=2 SV=2
7	Q8NQJ3	2.0	32.7	143	0.026	0.119	ODHI_CORGL Oxoglutarate dehydrogenase inhibitor OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) OX=196627 GN=odhI PE=1 SV=1
8	Q5A5Q6	2.3	33.5	449	0.040	0.058	ASH1_CANAL Transcriptional regulatory protein ASH1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=ASH1 PE=2 SV=1
9	Q8GWU0	2.3	33.5	301	0.029	0.063	PGP2_ARATH Phosphoglycolate phosphatase 2 OS=Arabidopsis thaliana OX=3702 GN=PGLP2 PE=1 SV=1
10	Q9FG34	3.0	33.1	358	0.035	0.064	PER54_ARATH Peroxidase 54 OS=Arabidopsis thaliana OX=3702 GN=PER54 PE=2 SV=1
11	P37613	3.4	31.6	127	0.040	0.205	PANZ_ECOLI PanD regulatory factor OS=Escherichia coli (strain K12) OX=83333 GN=panZ PE=1 SV=1
12	O65590	3.5	33.1	568	0.029	0.033	WRK34_ARATH Probable WRKY transcription factor 34 OS=Arabidopsis thaliana OX=3702 GN=WRKY34 PE=2 SV=1
13	P48360	3.8	33.1	493	0.025	0.032	ADRO_YEAST Probable NADPH:adrenodoxin oxidoreductase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ARH1 PE=1 SV=1
14	O74910	6.0	32.3	638	0.029	0.030	RAF1_SCHPO Rik1-associated factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=raf1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10156 Med17	4.6e-06	37.3	Subunit 17 of Mediator complex
2	PF18400 Thioredoxin_12	51	15.2	Thioredoxin-like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000251871

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000290663	0.999	Mediator of RNA polymerase II transcription subunit 8
2	9606.ENSP00000293777	0.999	Mediator of RNA polymerase II transcription subunit 11
3	9606.ENSP00000323720	0.999	Mediator of RNA polymerase II transcription subunit 14
4	9606.ENSP00000362948	0.999	Mediator of RNA polymerase II transcription subunit 18
5	9606.ENSP00000481920	0.999	Mediator of RNA polymerase II transcription subunit 6
6	9606.ENSP00000482438	0.999	Mediator of RNA polymerase II transcription subunit 22
7	9606.ENSP00000258648	0.998	Mediator of RNA polymerase II transcription subunit 4
8	9606.ENSP00000282892	0.997	Mediator of RNA polymerase II transcription subunit 21
9	9606.ENSP00000292035	0.997	Mediator of RNA polymerase II transcription subunit 27
10	9606.ENSP00000337340	0.997	Mediator of RNA polymerase II transcription subunit 19
11	9606.ENSP00000255764	0.996	Mediator of RNA polymerase II transcription subunit 10
12	9606.ENSP00000265350	0.996	Mediator of RNA polymerase II transcription subunit 20
13	9606.ENSP00000297347	0.996	Mediator of RNA polymerase II transcription subunit 30
14	9606.ENSP00000300651	0.996	Mediator of RNA polymerase II transcription subunit 1
15	9606.ENSP00000314343	0.996	Mediator of RNA polymerase II transcription subunit 29
16	9606.ENSP00000363193	0.996	Mediator of RNA polymerase II transcription subunit 12
17	9606.ENSP00000370938	0.996	Cyclin-dependent kinase 8
18	9606.ENSP00000325612	0.995	Mediator of RNA polymerase II transcription subunit 16
19	9606.ENSP00000380888	0.995	Mediator of RNA polymerase II transcription subunit 13
20	9606.ENSP00000286317	0.993	Mediator of RNA polymerase II transcription subunit 7

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0046966	0.999	nuclear thyroid hormone receptor binding
GO:0030374	0.995	nuclear receptor coactivator activity
GO:0019787	0.990	ubiquitin-like protein transferase activity
GO:0061659	0.835	ubiquitin-like protein ligase activity
GO:0004842	0.833	ubiquitin-protein transferase activity
GO:0061630	0.776	ubiquitin protein ligase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.966	organic substance metabolic process
GO:0044238	0.965	primary metabolic process
GO:0050789	0.947	regulation of biological process
GO:0043170	0.947	macromolecule metabolic process
GO:0006807	0.944	nitrogen compound metabolic process
GO:0048518	0.941	positive regulation of biological process
GO:0019222	0.936	regulation of metabolic process
GO:0050794	0.932	regulation of cellular process
GO:0044237	0.929	cellular metabolic process
GO:0009893	0.923	positive regulation of metabolic process
GO:0048522	0.918	positive regulation of cellular process
GO:0051173	0.907	positive regulation of nitrogen compound metabolic process
GO:0031325	0.907	positive regulation of cellular metabolic process
GO:0060255	0.906	regulation of macromolecule metabolic process
GO:0006351	0.902	DNA-templated transcription
GO:0051252	0.897	regulation of RNA metabolic process
GO:0006366	0.877	transcription by RNA polymerase II
GO:0010604	0.871	positive regulation of macromolecule metabolic process
GO:0045935	0.867	positive regulation of nucleobase-containing compound metabolic process
GO:0060260	0.856	regulation of transcription initiation by RNA polymerase II
GO:2000144	0.850	positive regulation of DNA-templated transcription initiation
GO:0060261	0.814	positive regulation of transcription initiation by RNA polymerase II
GO:1901564	0.789	organonitrogen compound metabolic process
GO:0032502	0.782	developmental process
GO:0098727	0.759	maintenance of cell number
GO:0036211	0.720	protein modification process
GO:0032501	0.678	multicellular organismal process
GO:0019827	0.648	stem cell population maintenance
GO:0006352	0.513	DNA-templated transcription initiation
GO:0035019	0.488	somatic stem cell population maintenance
GO:0070647	0.424	protein modification by small protein conjugation or removal

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0016592	0.996	mediator complex
GO:0016020	0.970	membrane
GO:0005667	0.942	transcription regulator complex
GO:0090575	0.932	RNA polymerase II transcription regulator complex
GO:1902494	0.928	catalytic complex
GO:0070847	0.890	core mediator complex
GO:1990234	0.871	transferase complex
GO:0140535	0.868	intracellular protein-containing complex
GO:0005737	0.418	cytoplasm
GO:0043232	0.378	intracellular non-membrane-bounded organelle
GO:0005829	0.303	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.994	Transferases.

[back to server]