StarFunc result for job id Q9NVD3

User Input

>input (440 residues)
MQKGKGRTSRIRRRKLCGSSESRGVNESHKSEFIELRKWLKARKFQDSNLAPACFPGTGR
GLMSQTSLQEGQMIISLPESCLLTTDTVIRSYLGAYITKWKPPPSPLLALCTFLVSEKHA
GHRSLWKPYLEILPKAYTCPVCLEPEVVNLLPKSLKAKAEEQRAHVQEFFASSRDFFSSL
QPLFAEAVDSIFSYSALLWAWCTVNTRAVYLRPRQRECLSAEPDTCALAPYLDLLNHSPH
VQVKAAFNEETHSYEIRTTSRWRKHEEVFICYGPHDNQRLFLEYGFVSVHNPHACVYVSR
EILVKYLPSTDKQMDKKISILKDHGYIENLTFGWDGPSWRLLTALKLLCLEAEKFTCWKK
VLLGEVISDTNEKTSLDIAQKICYYFIEETNAVLQKVSHMKDEKEALINQLTLVESLWTE
ELKILRASAETLHSLQTAFT

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NVD3	1.000	1.000	4.634E-78	440	1.000	1.000	Q9NVD3.pdb.gz	SETD4_HUMAN SET domain-containing protein 4 OS=Homo sapiens OX=9606 GN=SETD4 PE=1 SV=1
2	AFDB:P58467	0.975	0.978	5.829E-64	439	0.768	0.770	P58467.pdb.gz	SETD4_MOUSE SET domain-containing protein 4 OS=Mus musculus OX=10090 GN=Setd4 PE=1 SV=2
3	AFDB:A0A140C435	0.775	0.854	6.937E-29	397	0.248	0.275	A0A140C435.pdb.gz	SETD4_ARTPA SET domain-containing protein 4 OS=Artemia parthenogenetica OX=6663 GN=SETD4 PE=1 SV=1
4	AFDB:A0A384KCR9	0.744	0.657	1.104E-21	504	0.202	0.177	A0A384KCR9.pdb.gz	A0A384KCR9_ARATH (thale cress) hypothetical protein OS=Arabidopsis thaliana OX=3702 GN=At3g07670 PE=1 SV=1
5	AFDB:O74405	0.700	0.797	2.997E-21	381	0.211	0.244	O74405.pdb.gz	SET11_SCHPO Ribosomal lysine N-methyltransferase set11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=set11 PE=1 SV=1
6	PDB:6ox1B	0.673	0.620	1.447E-20	484	0.195	0.178	6ox1B.pdb.gz	Structural basis for the target specificity of actin histidine methyltransferase SETD3.
7	AFDB:Q9W3U1	0.667	0.557	1.269E-19	537	0.216	0.177	Q9W3U1.pdb.gz	SETD3_DROME Actin-histidine N-methyltransferase OS=Drosophila melanogaster OX=7227 GN=Setd3 PE=2 SV=2
8	AFDB:G3V6U9	0.657	0.504	3.119E-19	596	0.214	0.158	G3V6U9.pdb.gz	SETD3_RAT Actin-histidine N-methyltransferase OS=Rattus norvegicus OX=10116 GN=Setd3 PE=1 SV=1
9	AFDB:Q03942	0.752	0.696	1.034E-18	479	0.200	0.184	Q03942.pdb.gz	RKM2_YEAST Ribosomal lysine N-methyltransferase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RKM2 PE=1 SV=1
10	AFDB:Q9XI84	0.634	0.587	1.704E-18	482	0.200	0.183	Q9XI84.pdb.gz	RBCMT_ARATH [Fructose-bisphosphate aldolase]-lysine N-methyltransferase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=LSMT-L PE=1 SV=1
11	AFDB:Q7SXS7	0.673	0.515	4.864E-18	596	0.198	0.146	Q7SXS7.pdb.gz	SETD3_DANRE Actin-histidine N-methyltransferase OS=Danio rerio OX=7955 GN=setd3 PE=2 SV=1
12	PDB:3qxyA	0.651	0.678	4.049E-16	420	0.186	0.195	3qxyA.pdb.gz	Structural basis of SETD6-mediated regulation of the NF-kB network via methyl-lysine signaling.
13	PDB:5ex0A	0.352	0.360	3.718E-9	429	0.155	0.159	5ex0A.pdb.gz	Structural Basis for Substrate Preference of SMYD3, a SET Domain-containing Protein Lysine Methyltransferase
14	PDB:5v3hA	0.390	0.391	6.441E-9	438	0.164	0.164	5v3hA.pdb.gz	Small molecule inhibitors and CRISPR/Cas9 mutagenesis demonstrate that SMYD2 and SMYD3 activity are dispensable for autonomous cancer cell proliferation.
15	PDB:3n71A	0.367	0.349	2.742E-8	468	0.157	0.147	3n71A.pdb.gz	Crystal Structure of Cardiac-specific Histone Methyltransferase SmyD1 Reveals Unusual Active Site Architecture.
16	PDB:5h6zA	0.195	0.608	2.290E-2	123	0.064	0.228	5h6zA.pdb.gz
17	PDB:1pegA	0.182	0.280	4.608E-2	266	0.057	0.094	1pegA.pdb.gz	Structural basis for the product specificity of histone lysine methyltransferases
18	PDB:7td5A	0.209	0.187	5.628E-2	497	0.052	0.046	7td5A.pdb.gz	CK2-mediated phosphorylation of SUZ12 promotes PRC2 function by stabilizing enzyme active site.
19	PDB:2g46A	0.099	0.302	6.219E-2	119	0.034	0.126	2g46A.pdb.gz	Structural insights of the specificity and catalysis of a viral histone H3 lysine 27 methyltransferase.
20	PDB:5wg6A	0.095	0.082	6.872E-2	517	0.064	0.054	5wg6A.pdb.gz	An Evolutionarily Conserved Structural Platform for PRC2 Inhibition by a Class of Ezh2 Inhibitors.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P58467	0.0	656	439	0.741	0.743	SETD4_MOUSE SET domain-containing protein 4 OS=Mus musculus OX=10090 GN=Setd4 PE=1 SV=2
2	Q9NVD3	0.0	911	440	1.000	1.000	SETD4_HUMAN SET domain-containing protein 4 OS=Homo sapiens OX=9606 GN=SETD4 PE=1 SV=1
3	A0A140C435	2.07e-40	150	397	0.216	0.239	SETD4_ARTPA SET domain-containing protein 4 OS=Artemia parthenogenetica OX=6663 GN=SETD4 PE=1 SV=1
4	O74405	1.80e-26	112	381	0.189	0.218	SET11_SCHPO Ribosomal lysine N-methyltransferase set11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=set11 PE=1 SV=1
5	A0A384KCR9	9.20e-16	81.6	504	0.180	0.157	A0A384KCR9_ARATH (thale cress) hypothetical protein OS=Arabidopsis thaliana OX=3702 GN=At3g07670 PE=1 SV=1
6	Q86TU7	1.67e-12	71.6	594	0.205	0.152	SETD3_HUMAN Actin-histidine N-methyltransferase OS=Homo sapiens OX=9606 GN=SETD3 PE=1 SV=1
7	Q9XI84	2.59e-12	70.9	482	0.175	0.160	RBCMT_ARATH [Fructose-bisphosphate aldolase]-lysine N-methyltransferase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=LSMT-L PE=1 SV=1
8	Q9W3U1	3.39e-12	70.5	537	0.184	0.151	SETD3_DROME Actin-histidine N-methyltransferase OS=Drosophila melanogaster OX=7227 GN=Setd3 PE=2 SV=2
9	G3V6U9	1.07e-11	68.9	596	0.202	0.149	SETD3_RAT Actin-histidine N-methyltransferase OS=Rattus norvegicus OX=10116 GN=Setd3 PE=1 SV=1
10	Q91WC0	1.14e-11	68.9	594	0.195	0.145	SETD3_MOUSE Actin-histidine N-methyltransferase OS=Mus musculus OX=10090 GN=Setd3 PE=1 SV=1
11	O74738	3.24e-10	64.3	547	0.170	0.137	SET10_SCHPO Ribosomal lysine N-methyltransferase set10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=set10 PE=3 SV=1
12	Q7SXS7	3.50e-10	64.3	596	0.150	0.111	SETD3_DANRE Actin-histidine N-methyltransferase OS=Danio rerio OX=7955 GN=setd3 PE=2 SV=1
13	Q9FYK3	1.79e-09	62.0	476	0.143	0.132	Q9FYK3_ARATH F21J9.27 OS=Arabidopsis thaliana OX=3702 GN=At1g24610 PE=1 SV=1
14	P38732	2.19e-09	62.0	585	0.234	0.176	EFM1_YEAST Protein-lysine N-methyltransferase EFM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=EFM1 PE=1 SV=1
15	Q03942	1.16e-07	56.2	479	0.205	0.188	RKM2_YEAST Ribosomal lysine N-methyltransferase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RKM2 PE=1 SV=1
16	F6LJD1	1.37e-06	53.1	699	0.102	0.064	F6LJD1_CHLRE CIA6 OS=Chlamydomonas reinhardtii OX=3055 PE=2 SV=1
17	Q8VZB5	7.64e-06	50.4	514	0.143	0.123	Q8VZB5_ARATH Rubisco methyltransferase family protein OS=Arabidopsis thaliana OX=3702 GN=SAFE1 PE=1 SV=1
18	Q57UB6	1.23e-05	50.1	586	0.061	0.046	Q57UB6_TRYB2 SET domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb05.6E7.160 PE=4 SV=1
19	Q84JF5	0.004	42.0	483	0.102	0.093	PTA14_ARATH Protein PLASTID TRANSCRIPTIONALLY ACTIVE 14 OS=Arabidopsis thaliana OX=3702 GN=PTAC14 PE=1 SV=1
20	Q08961	0.005	41.6	583	0.130	0.098	RKM1_YEAST Ribosomal lysine N-methyltransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RKM1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09273 Rubis-subs-bind	2.9e-08	45.9	Rubisco LSMT substrate-binding
2	PF00856 SET	1.5e-09	50.0	SET domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000382163

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000219315	0.808	N-lysine methyltransferase SETD6
2	9606.ENSP00000380692	0.731	Lysine-specific demethylase 7A
3	9606.ENSP00000321498	0.721	Sugar phosphate exchanger 3
4	9606.ENSP00000372067	0.712	Protein arginine N-methyltransferase 8
5	9606.ENSP00000480958	0.699	Zinc finger protein 280B
6	9606.ENSP00000304192	0.697	Pecanex-like protein 1
7	9606.ENSP00000357829	0.696	EEF1A lysine methyltransferase 2
8	9606.ENSP00000273130	0.690	Cytoplasmic dynein 1 light intermediate chain 1
9	9606.ENSP00000357199	0.682	Protein RRNAD1
10	9606.ENSP00000370718	0.675	N-acetylserotonin O-methyltransferase-like protein
11	9606.ENSP00000264047	0.673	High affinity choline transporter 1
12	9606.ENSP00000365694	0.672	Serine/threonine-protein phosphatase 1 regulatory subunit 10
13	9606.ENSP00000367096	0.672	Protocadherin-9
14	9606.ENSP00000385852	0.669	SET domain-containing protein 5
15	9606.ENSP00000350874	0.667	Methyltransferase-like protein 9
16	9606.ENSP00000351686	0.662	PR domain zinc finger protein 10
17	9606.ENSP00000300305	0.642	Runt-related transcription factor 1
18	9606.ENSP00000308318	0.642	Protein phosphatase 1 regulatory subunit 3B
19	9606.ENSP00000304360	0.641	SET and MYND domain containing 4
20	9606.ENSP00000483489	0.635	N-terminal Xaa-Pro-Lys N-methyltransferase 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042054	1.000	histone methyltransferase activity
GO:0005515	0.999	protein binding
GO:0008757	0.996	S-adenosylmethionine-dependent methyltransferase activity
GO:0008170	0.996	N-methyltransferase activity
GO:0016279	0.984	protein-lysine N-methyltransferase activity
GO:0018024	0.952	histone lysine N-methyltransferase activity
GO:0140939	0.896	histone H4 methyltransferase activity
GO:0140938	0.444	histone H3 methyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0044238	0.996	primary metabolic process
GO:0006807	0.996	nitrogen compound metabolic process
GO:0044237	0.996	cellular metabolic process
GO:0043170	0.995	macromolecule metabolic process
GO:0050789	0.991	regulation of biological process
GO:0006479	0.988	protein methylation
GO:0018193	0.982	peptidyl-amino acid modification
GO:0050794	0.974	regulation of cellular process
GO:0018022	0.944	peptidyl-lysine methylation
GO:0019222	0.886	regulation of metabolic process
GO:0016571	0.837	histone methylation
GO:0010468	0.797	regulation of gene expression
GO:0048518	0.792	positive regulation of biological process
GO:0034968	0.791	histone lysine methylation
GO:0009893	0.601	positive regulation of metabolic process
GO:0010604	0.579	positive regulation of macromolecule metabolic process
GO:0048583	0.563	regulation of response to stimulus
GO:0051568	0.456	histone H3-K4 methylation
GO:0080134	0.333	regulation of response to stress
GO:0051239	0.327	regulation of multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005829	0.999	cytosol
GO:0070013	0.977	intracellular organelle lumen
GO:0005654	0.958	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.1.1.-	0.996	Methyltransferases.
RHEA:51736	0.984	L-lysyl-[protein] + S-adenosyl-L-methionine = H(+) + N(6)-methyl-L-lysyl-[protein] + S-adenosyl-L-homocysteine

[back to server]