StarFunc result for job id Q9NVE5

User Input

>input (1235 residues)
MFGDLFEEEYSTVSNNQYGKGKKLKTKALEPPAPREFTNLSGIRNQGGTCYLNSLLQTLH
FTPEFREALFSLGPEELGLFEDKDKPDAKVRIIPLQLQRLFAQLLLLDQEAASTADLTDS
FGWTSNEEMRQHDVQELNRILFSALETSLVGTSGHDLIYRLYHGTIVNQIVCKECKNVSE
RQEDFLDLTVAVKNVSGLEDALWNMYVEEEVFDCDNLYHCGTCDRLVKAAKSAKLRKLPP
FLTVSLLRFNFDFVKCERYKETSCYTFPLRINLKPFCEQSELDDLEYIYDLFSVIIHKGG
CYGGHYHVYIKDVDHLGNWQFQEEKSKPDVNLKDLQSEEEIDHPLMILKAILLEENNLIP
VDQLGQKLLKKIGISWNKKYRKQHGPLRKFLQLHSQIFLLSSDESTVRLLKNSSLQAESD
FQRNDQQIFKMLPPESPGLNNSISCPHWFDINDSKVQPIREKDIEQQFQGKESAYMLFYR
KSQLQRPPEARANPRYGVPCHLLNEMDAANIELQTKRAECDSANNTFELHLHLGPQYHFF
NGALHPVVSQTESVWDLTFDKRKTLGDLRQSIFQLLEFWEGDMVLSVAKLVPAGLHIYQS
LGGDELTLCETEIADGEDIFVWNGVEVGGVHIQTGIDCEPLLLNVLHLDTSSDGEKCCQV
IESPHVFPANAEVGTVLTALAIPAGVIFINSAGCPGGEGWTAIPKEDMRKTFREQGLRNG
SSILIQDSHDDNSLLTKEEKWVTSMNEIDWLHVKNLCQLESEEKQVKISATVNTMVFDIR
IKAIKELKLMKELADNSCLRPIDRNGKLLCPVPDSYTLKEAELKMGSSLGLCLGKAPSSS
QLFLFFAMGSDVQPGTEMEIVVEETISVRDCLKLMLKKSGLQGDAWHLRKMDWCYEAGEP
LCEEDATLKELLICSGDTLLLIEGQLPPLGFLKVPIWWYQLQGPSGHWESHQDQTNCTSS
WGRVWRATSSQGASGNEPAQVSLLYLGDIEISEDATLAELKSQAMTLPPFLEFGVPSPAH
LRAWTVERKRPGRLLRTDRQPLREYKLGRRIEICLEPLQKGENLGPQDVLLRTQVRIPGE
RTYAPALDLVWNAAQGGTAGSLRQRVADFYRLPVEKIEIAKYFPEKFEWLPISSWNQQIT
KRKKKKKQDYLQGAPYYLKDGDTIGVKNLLIDDDDDFSTIRDDTGKEKQKQRALGRRKSQ
EALHEQSSYILSSAETPARPRAPETSLSIHVGSFR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1Q7D2	0.604	0.593	0.000	1263	0.499	0.488	F1Q7D2.pdb.gz	F1Q7D2_DANRE Ubiquitin carboxyl-terminal hydrolase 40 OS=Danio rerio OX=7955 GN=usp40 PE=1 SV=1
2	AFDB:Q8BY87	0.377	0.347	8.184E-56	1376	0.186	0.167	Q8BY87.pdb.gz	UBP47_MOUSE Ubiquitin carboxyl-terminal hydrolase 47 OS=Mus musculus OX=10090 GN=Usp47 PE=1 SV=2
3	AFDB:Q9UTT1	0.304	0.330	5.197E-53	1129	0.143	0.156	Q9UTT1.pdb.gz	UBP71_SCHPO Ubiquitin carboxyl-terminal hydrolase 15 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubp15 PE=1 SV=2
4	AFDB:Q09879	0.372	0.406	1.537E-52	1108	0.156	0.174	Q09879.pdb.gz	UBP72_SCHPO Ubiquitin carboxyl-terminal hydrolase 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ubp5 PE=1 SV=3
5	AFDB:Q9FPT1	0.382	0.413	1.115E-50	1116	0.155	0.171	Q9FPT1.pdb.gz	UBP12_ARATH Ubiquitin C-terminal hydrolase 12 OS=Arabidopsis thaliana OX=3702 GN=UBP12 PE=1 SV=2
6	AFDB:Q22240	0.316	0.301	1.817E-50	1326	0.185	0.172	Q22240.pdb.gz	Q22240_CAEEL Ubiquitin carboxyl-terminal hydrolase 47 OS=Caenorhabditis elegans OX=6239 GN=CELE_T05H10.1 PE=1 SV=2
7	AFDB:P50101	0.277	0.278	3.219E-49	1230	0.166	0.167	P50101.pdb.gz	UBP15_YEAST Ubiquitin carboxyl-terminal hydrolase 15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UBP15 PE=1 SV=1
8	AFDB:Q7JKC3	0.339	0.362	5.845E-49	1135	0.150	0.163	Q7JKC3.pdb.gz	UBP7_CAEEL Ubiquitin carboxyl-terminal hydrolase 7 OS=Caenorhabditis elegans OX=6239 GN=math-33 PE=3 SV=1
9	AFDB:Q24574	0.290	0.238	8.093E-49	1556	0.177	0.141	Q24574.pdb.gz	UBPE_DROME Ubiquitin carboxyl-terminal hydrolase 47 OS=Drosophila melanogaster OX=7227 GN=Usp47 PE=1 SV=2
10	AFDB:Q9VYQ8	0.253	0.275	1.154E-47	1129	0.142	0.155	Q9VYQ8.pdb.gz	UBP7_DROME Ubiquitin carboxyl-terminal hydrolase 7 OS=Drosophila melanogaster OX=7227 GN=Usp7 PE=1 SV=1
11	PDB:7yxxA	0.253	0.180	5.602E-24	1754	0.079	0.056	7yxxA.pdb.gz
12	PDB:3mhsA	0.221	0.561	7.200E-21	455	0.074	0.200	3mhsA.pdb.gz	Structural insights into the assembly and function of the SAGA deubiquitinating module.
13	PDB:5k16B	0.215	0.735	2.877E-19	328	0.065	0.244	5k16B.pdb.gz	Allosteric Activation of Ubiquitin-Specific Proteases by beta-Propeller Proteins UAF1 and WDR20.
14	PDB:5cvnB	0.220	0.796	3.983E-19	321	0.071	0.274	5cvnB.pdb.gz	Structural Insights into WD-Repeat 48 Activation of Ubiquitin-Specific Protease 46.
15	PDB:7ay1D	0.221	0.737	3.486E-18	341	0.071	0.258	7ay1D.pdb.gz	Structural basis of FANCD2 deubiquitination by USP1-UAF1.
16	PDB:8a9kD	0.197	0.787	3.885E-18	285	0.066	0.288	8a9kD.pdb.gz	Cryo-EM reveals a mechanism of USP1 inhibition through a cryptic binding site.
17	PDB:7w3ax	0.218	0.516	5.849E-17	494	0.066	0.164	7w3ax.pdb.gz	USP14-regulated allostery of the human proteasome by time-resolved cryo-EM.
18	PDB:4fjcE	0.201	0.528	7.671E-17	434	0.066	0.189	4fjcE.pdb.gz	A Role for Intersubunit Interactions in Maintaining SAGA Deubiquitinating Module Structure and Activity.
19	PDB:5gjqx	0.208	0.667	1.319E-16	355	0.064	0.223	5gjqx.pdb.gz	An atomic structure of the human 26S proteasome.
20	PDB:7qo48	0.218	0.678	2.396E-16	372	0.059	0.196	7qo48.pdb.gz	Allosteric control of Ubp6 and the proteasome via a bidirectional switch.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1Q7D2	0.0	1187	1263	0.510	0.499	F1Q7D2_DANRE Ubiquitin carboxyl-terminal hydrolase 40 OS=Danio rerio OX=7955 GN=usp40 PE=1 SV=1
2	Q84WU2	5.67e-44	176	1115	0.092	0.102	UBP13_ARATH Ubiquitin C-terminal hydrolase 13 OS=Arabidopsis thaliana OX=3702 GN=UBP13 PE=1 SV=1
3	Q9FPT1	2.20e-42	171	1116	0.089	0.099	UBP12_ARATH Ubiquitin C-terminal hydrolase 12 OS=Arabidopsis thaliana OX=3702 GN=UBP12 PE=1 SV=2
4	P50101	9.94e-41	166	1230	0.086	0.086	UBP15_YEAST Ubiquitin carboxyl-terminal hydrolase 15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UBP15 PE=1 SV=1
5	Q93009	2.33e-40	165	1102	0.081	0.091	UBP7_HUMAN Ubiquitin carboxyl-terminal hydrolase 7 OS=Homo sapiens OX=9606 GN=USP7 PE=1 SV=2
6	Q4VSI4	2.75e-40	164	1103	0.081	0.091	UBP7_RAT Ubiquitin carboxyl-terminal hydrolase 7 OS=Rattus norvegicus OX=10116 GN=Usp7 PE=1 SV=1
7	Q6A4J8	6.67e-40	163	1103	0.080	0.090	UBP7_MOUSE Ubiquitin carboxyl-terminal hydrolase 7 OS=Mus musculus OX=10090 GN=Usp7 PE=1 SV=1
8	Q24574	9.27e-40	164	1556	0.079	0.062	UBPE_DROME Ubiquitin carboxyl-terminal hydrolase 47 OS=Drosophila melanogaster OX=7227 GN=Usp47 PE=1 SV=2
9	I3ISS5	1.70e-39	162	1103	0.080	0.090	I3ISS5_DANRE Ubiquitin carboxyl-terminal hydrolase 7 OS=Danio rerio OX=7955 GN=usp7 PE=1 SV=1
10	F1QUS9	1.75e-39	162	1110	0.080	0.089	F1QUS9_DANRE Ubiquitin carboxyl-terminal hydrolase 7 OS=Danio rerio OX=7955 GN=usp7 PE=1 SV=1
11	Q96K76	2.05e-39	162	1375	0.088	0.079	UBP47_HUMAN Ubiquitin carboxyl-terminal hydrolase 47 OS=Homo sapiens OX=9606 GN=USP47 PE=1 SV=3
12	Q8BY87	8.19e-39	160	1376	0.075	0.068	UBP47_MOUSE Ubiquitin carboxyl-terminal hydrolase 47 OS=Mus musculus OX=10090 GN=Usp47 PE=1 SV=2
13	G3MU82	1.21e-37	156	1132	0.080	0.087	G3MU82_CAEEL Ubiquitin carboxyl-terminal hydrolase 7 OS=Caenorhabditis elegans OX=6239 GN=math-33 PE=1 SV=1
14	G3MU83	1.26e-37	156	1134	0.080	0.087	G3MU83_CAEEL Ubiquitin carboxyl-terminal hydrolase 7 OS=Caenorhabditis elegans OX=6239 GN=math-33 PE=1 SV=1
15	O45624	1.30e-37	156	1130	0.080	0.088	O45624_CAEEL Ubiquitin carboxyl-terminal hydrolase 7 OS=Caenorhabditis elegans OX=6239 GN=math-33 PE=1 SV=1
16	G3MU79	1.32e-37	156	1131	0.080	0.088	G3MU79_CAEEL Ubiquitin carboxyl-terminal hydrolase 7 OS=Caenorhabditis elegans OX=6239 GN=math-33 PE=1 SV=1
17	G3MU80	1.32e-37	156	1132	0.080	0.087	G3MU80_CAEEL Ubiquitin carboxyl-terminal hydrolase 7 OS=Caenorhabditis elegans OX=6239 GN=math-33 PE=1 SV=1
18	Q7JKC3	1.33e-37	156	1135	0.080	0.087	UBP7_CAEEL Ubiquitin carboxyl-terminal hydrolase 7 OS=Caenorhabditis elegans OX=6239 GN=math-33 PE=3 SV=1
19	G3MU81	1.37e-37	156	1129	0.080	0.088	G3MU81_CAEEL Ubiquitin carboxyl-terminal hydrolase 7 OS=Caenorhabditis elegans OX=6239 GN=math-33 PE=1 SV=1
20	O45623	1.45e-37	156	1133	0.080	0.087	O45623_CAEEL Ubiquitin carboxyl-terminal hydrolase 7 OS=Caenorhabditis elegans OX=6239 GN=math-33 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16110 DUF4828	3.7e+02	13.0	Domain of unknown function (DUF4828)
2	PF00443 UCH	2.7e-38	143.7	Ubiquitin carboxyl-terminal hydrolase
3	PF13423 UCH_1	1.2e-09	49.9	Ubiquitin carboxyl-terminal hydrolase
4	PF08817 YukD	50	16.1	WXG100 protein secretion system (Wss), protein YukD

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000415434

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000264607	0.789	Ankyrin repeat and SOCS box protein 1
2	9606.ENSP00000264057	0.756	Diacylglycerol kinase delta
3	9606.ENSP00000294409	0.745	Glucocorticoid modulatory element-binding protein 1
4	9606.ENSP00000362424	0.741	TRAF3-interacting protein 1
5	9606.ENSP00000168148	0.701	Secreted phosphoprotein 24
6	9606.ENSP00000282007	0.698	Zinc finger CCCH domain-containing protein 13
7	9606.ENSP00000264249	0.694	Carbohydrate sulfotransferase 10
8	9606.ENSP00000266037	0.694	Dedicator of cytokinesis protein 3
9	9606.ENSP00000265316	0.679	ATP-binding cassette sub-family B member 6, mitochondrial
10	9606.ENSP00000342222	0.665	Transient receptor potential cation channel subfamily V member 2
11	9606.ENSP00000339754	0.664	ADP-ribosylation factor-like protein 4C
12	9606.ENSP00000405338	0.641	Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1
13	9606.ENSP00000314004	0.626	Anaphase-promoting complex subunit 2
14	9606.ENSP00000387362	0.626	Ubiquitin conjugation factor E4 A
15	9606.ENSP00000386717	0.598	Ribosomal protein L31
16	9606.ENSP00000373696	0.595	E3 ubiquitin-protein ligase TRIP12
17	9606.ENSP00000233840	0.591	Sialidase-2
18	9606.ENSP00000441543	0.583	Polyubiquitin-C
19	9606.ENSP00000219313	0.581	26S proteasome non-ATPase regulatory subunit 7
20	9606.ENSP00000337572	0.581	Diacylglycerol kinase eta

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0004843	1.000	cysteine-type deubiquitinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032502	0.836	developmental process
GO:0032501	0.830	multicellular organismal process
GO:0009987	0.790	cellular process
GO:0048856	0.710	anatomical structure development
GO:0008152	0.707	metabolic process
GO:0071704	0.673	organic substance metabolic process
GO:0044238	0.648	primary metabolic process
GO:0007275	0.635	multicellular organism development
GO:0065007	0.610	biological regulation
GO:0006807	0.578	nitrogen compound metabolic process
GO:0048731	0.542	system development
GO:0043170	0.526	macromolecule metabolic process
GO:1901564	0.516	organonitrogen compound metabolic process
GO:0048513	0.493	animal organ development
GO:0070647	0.492	protein modification by small protein conjugation or removal
GO:0050789	0.484	regulation of biological process
GO:0050794	0.388	regulation of cellular process
GO:0006508	0.374	proteolysis
GO:0072001	0.316	renal system development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	0.999	nucleus
GO:0005829	0.991	cytosol
GO:0070013	0.808	intracellular organelle lumen
GO:0031981	0.633	nuclear lumen
GO:0005654	0.395	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.19.12	1.000	ubiquitinyl hydrolase 1.

[back to server]