StarFunc result for job id Q9NVF9

User Input

>input (386 residues)
MAVPPSAPQPRASFHLRRHTPCPQCSWGMEEKAAASASCREPPGPPRAAAVAYFGISVDP
DDILPGALRLIQELRPHWKPEQVRTKRFTDGITNKLVACYVEEDMQDCVLVRVYGERTEL
LVDRENEVRNFQLLRAHSCAPKLYCTFQNGLCYEYMQGVALEPEHIREPRLFRLIALEMA
KIHTIHANGSLPKPILWHKMHNYFTLVKNEINPSLSADVPKVEVLERELAWLKEHLSQLE
SPVVFCHNDLLCKNIIYDSIKGHVRFIDYEYAGYNYQAFDIGNHFNEFAGVNEVDYCLYP
ARETQLQWLHYYLQAQKGMAVTPREVQRLYVQVNKFALASHFFWALWALIQNQYSTIDFD
FLRYAVIRFNQYFKVKPQASALEMPK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NVF9	1.000	1.000	1.993E-67	386	1.000	1.000	Q9NVF9.pdb.gz	EKI2_HUMAN Ethanolamine kinase 2 OS=Homo sapiens OX=9606 GN=ETNK2 PE=1 SV=3
2	AFDB:A7MCT6	0.927	0.930	3.504E-59	385	0.873	0.875	A7MCT6.pdb.gz	EKI2_MOUSE Ethanolamine kinase 2 OS=Mus musculus OX=10090 GN=Etnk2 PE=1 SV=1
3	AFDB:Q9HBU6	0.859	0.735	6.361E-44	452	0.562	0.480	Q9HBU6.pdb.gz	EKI1_HUMAN Ethanolamine kinase 1 OS=Homo sapiens OX=9606 GN=ETNK1 PE=1 SV=1
4	AFDB:P54352	0.836	0.627	1.148E-34	518	0.427	0.319	P54352.pdb.gz	EAS_DROME Ethanolamine kinase OS=Drosophila melanogaster OX=7227 GN=eas PE=1 SV=2
5	AFDB:O81024	0.783	0.807	2.404E-29	374	0.319	0.329	O81024.pdb.gz	EKI_ARATH Probable ethanolamine kinase OS=Arabidopsis thaliana OX=3702 GN=EMB1187 PE=2 SV=1
6	AFDB:Q9Y259	0.719	0.704	9.240E-24	395	0.293	0.286	Q9Y259.pdb.gz	CHKB_HUMAN Choline/ethanolamine kinase OS=Homo sapiens OX=9606 GN=CHKB PE=1 SV=3
7	PDB:2ig7B	0.717	0.804	2.638E-23	342	0.277	0.313	2ig7B.pdb.gz
8	AFDB:Q9M9H6	0.744	0.826	3.813E-23	346	0.254	0.283	Q9M9H6.pdb.gz	CK1_ARATH Probable choline kinase 1 OS=Arabidopsis thaliana OX=3702 GN=CK1 PE=2 SV=1
9	AFDB:Q8IIB7	0.750	0.687	1.741E-22	423	0.256	0.234	Q8IIB7.pdb.gz	Q8IIB7_PLAF7 Ethanolamine kinase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1124600 PE=4 SV=1
10	AFDB:O54804	0.724	0.623	3.538E-22	453	0.293	0.249	O54804.pdb.gz	CHKA_MOUSE Choline kinase alpha OS=Mus musculus OX=10090 GN=Chka PE=1 SV=3
11	AFDB:P35790	0.714	0.611	5.042E-22	457	0.293	0.247	P35790.pdb.gz	CHKA_HUMAN Choline kinase alpha OS=Homo sapiens OX=9606 GN=CHKA PE=1 SV=3
12	PDB:1nw1A	0.715	0.753	7.652E-21	365	0.256	0.271	1nw1A.pdb.gz	The Crystal Structure of Choline Kinase Reveals a Eukaryotic Protein Kinase Fold
13	PDB:4da5A	0.690	0.751	1.037E-20	352	0.254	0.278	4da5A.pdb.gz	Kinetic and mechanistic characterisation of Choline Kinase-alpha.
14	PDB:4wh3A	0.493	0.526	6.009E-9	356	0.142	0.154	4wh3A.pdb.gz	Open-close structural change upon ligand binding and two magnesium ions required for the catalysis of N-acetylhexosamine 1-kinase
15	PDB:1zylA	0.490	0.558	3.279E-7	325	0.135	0.160	1zylA.pdb.gz
16	PDB:2pywA	0.489	0.459	1.163E-6	417	0.132	0.122	2pywA.pdb.gz	Structure of A. thaliana 5-methylthioribose kinase in complex with ADP and MTR reveals a more occluded active site than its bacterial homolog
17	PDB:5oniA	0.289	0.329	6.345E-5	334	0.111	0.129	5oniA.pdb.gz	Unexpected Binding Mode of a Potent Indeno[1,2-b]indole-Type Inhibitor of Protein Kinase CK2 Revealed by Complex Structures with the Catalytic Subunit CK2 alpha and Its Paralog CK2 alpha '.
18	PDB:5xvuA	0.293	0.342	1.001E-4	321	0.080	0.097	5xvuA.pdb.gz	The protein kinase CK2 catalytic domain from Plasmodium falciparum: crystal structure, tyrosine kinase activity and inhibition.
19	PDB:6bcuA	0.219	0.059	1.578E-4	2204	0.117	0.020	6bcuA.pdb.gz	Mechanisms of mTORC1 activation by RHEB and inhibition by PRAS40.
20	PDB:4ww9A	0.283	0.418	1.746E-4	238	0.083	0.134	4ww9A.pdb.gz	Crystal structures of the Gon7/Pcc1 and Bud32/Cgi121 complexes provide a model for the complete yeast KEOPS complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A7MCT6	0.0	701	385	0.873	0.875	EKI2_MOUSE Ethanolamine kinase 2 OS=Mus musculus OX=10090 GN=Etnk2 PE=1 SV=1
2	Q9NVF9	0.0	808	386	1.000	1.000	EKI2_HUMAN Ethanolamine kinase 2 OS=Homo sapiens OX=9606 GN=ETNK2 PE=1 SV=3
3	Q9HBU6	4.07e-154	444	452	0.539	0.460	EKI1_HUMAN Ethanolamine kinase 1 OS=Homo sapiens OX=9606 GN=ETNK1 PE=1 SV=1
4	P54352	4.22e-87	275	518	0.435	0.324	EAS_DROME Ethanolamine kinase OS=Drosophila melanogaster OX=7227 GN=eas PE=1 SV=2
5	O81024	2.34e-67	219	374	0.311	0.321	EKI_ARATH Probable ethanolamine kinase OS=Arabidopsis thaliana OX=3702 GN=EMB1187 PE=2 SV=1
6	Q9M9H6	2.64e-51	177	346	0.244	0.272	CK1_ARATH Probable choline kinase 1 OS=Arabidopsis thaliana OX=3702 GN=CK1 PE=2 SV=1
7	Q9Y259	3.37e-46	164	395	0.290	0.284	CHKB_HUMAN Choline/ethanolamine kinase OS=Homo sapiens OX=9606 GN=CHKB PE=1 SV=3
8	O54783	2.47e-43	157	394	0.272	0.266	CHKB_RAT Choline/ethanolamine kinase OS=Rattus norvegicus OX=10116 GN=Chkb PE=1 SV=3
9	O55229	6.91e-43	155	394	0.267	0.261	CHKB_MOUSE Choline/ethanolamine kinase OS=Mus musculus OX=10090 GN=Chkb PE=1 SV=3
10	Q8IIB7	2.82e-39	147	423	0.267	0.243	Q8IIB7_PLAF7 Ethanolamine kinase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1124600 PE=4 SV=1
11	O54804	1.52e-35	137	453	0.285	0.243	CHKA_MOUSE Choline kinase alpha OS=Mus musculus OX=10090 GN=Chka PE=1 SV=3
12	Q01134	1.98e-35	137	453	0.288	0.245	CHKA_RAT Choline kinase alpha OS=Rattus norvegicus OX=10116 GN=Chka PE=1 SV=2
13	P35790	5.00e-35	135	457	0.277	0.234	CHKA_HUMAN Choline kinase alpha OS=Homo sapiens OX=9606 GN=CHKA PE=1 SV=3
14	Q22942	5.09e-29	119	429	0.262	0.235	CKA2_CAEEL Choline kinase A2 OS=Caenorhabditis elegans OX=6239 GN=cka-2 PE=1 SV=2
15	Q386V0	6.04e-26	110	431	0.262	0.234	Q386V0_TRYB2 Choline/ethanolamine kinase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.18.0017 PE=4 SV=1
16	Q8IM71	4.31e-22	99.4	440	0.225	0.198	Q8IM71_PLAF7 Choline kinase OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1401800 PE=1 SV=1
17	E9ADC3	7.13e-22	99.8	642	0.256	0.154	E9ADC3_LEIMA Choline kinase OS=Leishmania major OX=5664 GN=LMJF_27_1420 PE=4 SV=1
18	B3GWD5	3.78e-18	87.8	448	0.251	0.217	B3GWD5_CAEEL Choline/ethanolamine kinase OS=Caenorhabditis elegans OX=6239 GN=cka-1 PE=1 SV=1
19	O17610	6.58e-18	87.4	474	0.251	0.205	O17610_CAEEL Choline/ethanolamine kinase OS=Caenorhabditis elegans OX=6239 GN=cka-1 PE=1 SV=2
20	P20485	7.13e-18	87.4	582	0.205	0.136	KICH_YEAST Choline kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CKI1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01636 APH	1.6e-11	56.1	Phosphotransferase enzyme family
2	PF01633 Choline_kinase	5.2e-56	201.2	Choline/ethanolamine kinase
3	PF02958 EcKL	18	16.1	Ecdysteroid kinase-like family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000010564

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000015823	0.975	Phosphate cytidylyltransferase 2, ethanolamine
2	60711.ENSCSAP00000009588	0.913	Glycerophosphocholine phosphodiesterase GDE1 homolog (S. cerevisiae)
3	60711.ENSCSAP00000000328	0.908	Ethanolamine-phosphate phospho-lyase
4	60711.ENSCSAP00000004830	0.804	Uncharacterized protein
5	60711.ENSCSAP00000010485	0.804	Phosphate cytidylyltransferase 1, choline, beta
6	60711.ENSCSAP00000004210	0.694	Transfers the glycosyl residue from UDP-Glc to the non- reducing end of alpha-1,4-glucan
7	60711.ENSCSAP00000010632	0.681	Golgi transport 1A
8	60711.ENSCSAP00000015501	0.675	Aldehyde dehydrogenase 16 family, member A1
9	60711.ENSCSAP00000010640	0.665	Pleckstrin homology domain containing, family A member 6
10	60711.ENSCSAP00000015465	0.660	PIH1 domain containing 1
11	60711.ENSCSAP00000010667	0.649	Phosphatidylinositol-4-phosphate 3-kinase, catalytic subunit type 2 beta
12	60711.ENSCSAP00000004204	0.648	Lactate dehydrogenase B
13	60711.ENSCSAP00000004216	0.559	Spexin hormone
14	60711.ENSCSAP00000005207	0.555	Choline kinase alpha
15	60711.ENSCSAP00000001116	0.549	annotation not available
16	60711.ENSCSAP00000015407	0.535	TEA domain family member 2
17	60711.ENSCSAP00000000685	0.529	Uncharacterized protein
18	60711.ENSCSAP00000007609	0.528	Phosphatidylinositol-4,5-bisphosphate 3-kinase, catalytic subunit gamma
19	60711.ENSCSAP00000018264	0.514	Small nuclear ribonucleoprotein polypeptide E
20	60711.ENSCSAP00000016965	0.512	IQ motif containing C

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016773	1.000	phosphotransferase activity, alcohol group as acceptor
GO:0016301	1.000	kinase activity
GO:0005488	0.997	binding
GO:0005515	0.991	protein binding
GO:0004305	0.943	ethanolamine kinase activity
GO:0004103	0.538	choline kinase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.998	organic substance metabolic process
GO:0044238	0.998	primary metabolic process
GO:0044237	0.998	cellular metabolic process
GO:0006644	0.992	phospholipid metabolic process
GO:0006650	0.976	glycerophospholipid metabolic process
GO:0008654	0.976	phospholipid biosynthetic process
GO:0046474	0.964	glycerophospholipid biosynthetic process
GO:0046337	0.892	phosphatidylethanolamine metabolic process
GO:0006807	0.447	nitrogen compound metabolic process
GO:0032501	0.390	multicellular organismal process
GO:1901564	0.339	organonitrogen compound metabolic process
GO:0032502	0.327	developmental process
GO:0048856	0.317	anatomical structure development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.997	cytosol
GO:0043231	0.427	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.1.-	1.000	Phosphotransferases with an alcohol group as acceptor.
RHEA:13069	0.943	ATP + ethanolamine = ADP + H(+) + phosphoethanolamine
EC:2.7.1.82	0.943	ethanolamine kinase.
RHEA:12837	0.538	ATP + choline = ADP + H(+) + phosphocholine
EC:2.7.1.32	0.538	choline kinase.

[back to server]