StarFunc result for job id Q9NVH2

User Input

>input (962 residues)
MASNSTKSFLADAGYGEQELDANSALMELDKGLRSGKLGEQCEAVVRFPRLFQKYPFPIL
INSAFLKLADVFRVGNNFLRLCVLKVTQQSEKHLEKILNVDEFVKRIFSVIHSNDPVARA
ITLRMLGSLASIIPERKNAHHSIRQSLDSHDNVEVEAAVFAAANFSAQSKDFAVGICNKI
SEMIQGLATPVDLKLKLIPILQHMHHDAILASSARQLLQQLVTSYPSTKMVIVSLHTFTL
LAASSLVDTPKQIQLLLQYLKNDPRKAVKRLAIQDLKLLANKTPHTWSRENIQALCECAL
QTPYDSLKLGMLSVLSTLSGTIAIKHYFSIVPGNVSSSPRSSDLVKLAQECCYHNNRGIA
AHGVRVLTNITVSCQEKDLLALEQDAVFGLESLLVLCSQDDSPGAQATLKIALNCMVKLA
KGRPHLSQSVVETLLTQLHSAQDAARILMCHCLAAIAMQLPVLGDGMLGDLMELYKVIGR
SATDKQQELLVSLATVIFVASQKALSVESKAVIKQQLESVSNGWTVYRIARQASRMGNHD
MAKELYQSLLTQVASEHFYFWLNSLKEFSHAEQCLTGLQEENYSSALSCIAESLKFYHKG
IASLTAASTPLNPLSFQCEFVKLRIDLLQAFSQLICTCNSLKTSPPPAIATTIAMTLGND
LQRCGRISNQMKQSMEEFRSLASRYGDLYQASFDADSATLRNVELQQQSCLLISHAIEAL
ILDPESASFQEYGSTGTAHADSEYERRMMSVYNHVLEEVESLNRKYTPVSYMHTACLCNA
IIALLKVPLSFQRYFFQKLQSTSIKLALSPSPRNPAEPIAVQNNQQLALKVEGVVQHGSK
PGLFRKIQSVCLNVSSTLQSKSGQDYKIPIDNMTNEMEQRVEPHNDYFSTQFLLNFAILG
THNITVESSVKDANGIVWKTGPRTTIFVKSLEDPYSQQIRLQQQQAQQPLQQQQQRNAYT
RF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NVH2	1.000	1.000	0.000	962	1.000	1.000	Q9NVH2.pdb.gz	INT7_HUMAN Integrator complex subunit 7 OS=Homo sapiens OX=9606 GN=INTS7 PE=1 SV=1
2	AFDB:Q8JGR7	0.961	0.959	3.358E-93	964	0.755	0.753	Q8JGR7.pdb.gz	INT7_DANRE Integrator complex subunit 7 OS=Danio rerio OX=7955 GN=ints7 PE=2 SV=1
3	PDB:7cunG	0.875	0.938	3.107E-84	895	0.929	0.999	7cunG.pdb.gz	Identification of Integrator-PP2A complex (INTAC), an RNA polymerase II phosphatase.
4	AFDB:Q9VT41	0.861	0.829	1.768E-53	1001	0.339	0.326	Q9VT41.pdb.gz	INT7_DROME Integrator complex subunit 7 OS=Drosophila melanogaster OX=7227 GN=defl PE=1 SV=1
5	AFDB:O49433	0.648	0.564	1.868E-24	1134	0.173	0.146	O49433.pdb.gz	O49433_ARATH ARM repeat superfamily protein OS=Arabidopsis thaliana OX=3702 GN=EMB1895 PE=1 SV=1
6	AFDB:P32074	0.294	0.301	2.165E-11	935	0.132	0.136	P32074.pdb.gz	COPG_YEAST Coatomer subunit gamma OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=SEC21 PE=1 SV=2
7	AFDB:Q8VZA0	0.281	0.287	5.077E-10	936	0.119	0.122	Q8VZA0.pdb.gz	SIEL_ARATH Protein SIEL OS=Arabidopsis thaliana OX=3702 GN=SIEL PE=1 SV=1
8	AFDB:Q9W3E1	0.242	0.231	9.011E-10	1022	0.119	0.112	Q9W3E1.pdb.gz	INT4_DROME Integrator complex subunit 4 OS=Drosophila melanogaster OX=7227 GN=IntS4 PE=1 SV=1
9	AFDB:P87140	0.279	0.292	1.003E-9	905	0.122	0.129	P87140.pdb.gz	COPG_SCHPO Probable coatomer subunit gamma OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=sec21 PE=1 SV=1
10	AFDB:Q8I0G5	0.306	0.327	1.003E-9	883	0.114	0.125	Q8I0G5.pdb.gz	COPG_DROME Coatomer subunit gamma OS=Drosophila melanogaster OX=7227 GN=gammaCOP PE=2 SV=1
11	AFDB:P53620	0.288	0.308	2.549E-9	874	0.111	0.122	P53620.pdb.gz	COPG1_BOVIN Coatomer subunit gamma-1 OS=Bos taurus OX=9913 GN=COPG1 PE=1 SV=1
12	PDB:7cunD	0.310	0.351	9.472E-8	827	0.117	0.137	7cunD.pdb.gz	Identification of Integrator-PP2A complex (INTAC), an RNA polymerase II phosphatase.
13	PDB:3nd2A	0.411	0.449	3.322E-7	861	0.088	0.099	3nd2A.pdb.gz
14	PDB:4jlqA	0.352	0.393	5.488E-7	840	0.105	0.120	4jlqA.pdb.gz	Crystal structure of human Karyopherin beta 2 bound to the PY-NLS of Saccharomyces cerevisiae Nab2.
15	PDB:7rroH7	0.241	0.362	8.747E-7	580	0.074	0.122	7rroH7.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
16	PDB:4a0cA	0.325	0.281	1.252E-6	1155	0.112	0.094	4a0cA.pdb.gz	The Molecular Basis of Crl4(Ddb2/Csa) Ubiquitin Ligase Architecture, Targeting, and Activation
17	PDB:2z6gA	0.232	0.363	1.498E-6	550	0.086	0.151	2z6gA.pdb.gz
18	PDB:6bcuA	0.226	0.107	1.609E-6	2204	0.128	0.056	6bcuA.pdb.gz	Mechanisms of mTORC1 activation by RHEB and inhibition by PRAS40.
19	PDB:6kbnC	0.217	0.334	1.668E-6	504	0.090	0.173	6kbnC.pdb.gz	Quaternary structures of Vac8 differentially regulate the Cvt and PMN pathways.
20	PDB:1b3uA	0.290	0.434	2.303E-6	588	0.072	0.117	1b3uA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8JGR7	0.0	1497	964	0.763	0.761	INT7_DANRE Integrator complex subunit 7 OS=Danio rerio OX=7955 GN=ints7 PE=2 SV=1
2	Q9NVH2	0.0	1986	962	1.000	1.000	INT7_HUMAN Integrator complex subunit 7 OS=Homo sapiens OX=9606 GN=INTS7 PE=1 SV=1
3	Q9VT41	1.01e-165	513	1001	0.367	0.353	INT7_DROME Integrator complex subunit 7 OS=Drosophila melanogaster OX=7227 GN=defl PE=1 SV=1
4	O49433	2.45e-07	57.4	1134	0.064	0.055	O49433_ARATH ARM repeat superfamily protein OS=Arabidopsis thaliana OX=3702 GN=EMB1895 PE=1 SV=1
5	A0A0H2UQR2	1.6	34.7	403	0.028	0.067	A0A0H2UQR2_STRPN TPR domain protein OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) OX=170187 GN=SP_1504 PE=1 SV=1
6	Q99LG2	3.1	34.3	887	0.023	0.025	TNPO2_MOUSE Transportin-2 OS=Mus musculus OX=10090 GN=Tnpo2 PE=1 SV=1
7	O14787	3.2	34.3	897	0.023	0.025	TNPO2_HUMAN Transportin-2 OS=Homo sapiens OX=9606 GN=TNPO2 PE=1 SV=3
8	Q9H0H0	3.9	33.9	1204	0.023	0.018	INT2_HUMAN Integrator complex subunit 2 OS=Homo sapiens OX=9606 GN=INTS2 PE=1 SV=2
9	A4QN36	5.1	33.1	425	0.023	0.052	A4QN36_DANRE Pellino E3 ubiquitin protein ligase 1b OS=Danio rerio OX=7955 GN=zgc:153297 PE=2 SV=1
10	F4I9A2	7.6	33.1	1767	0.034	0.019	TNO1_ARATH Trans-Golgi network-localized SYP41-interacting protein 1 OS=Arabidopsis thaliana OX=3702 GN=TNO1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13646 HEAT_2	1.8	20.3	HEAT repeats
2	PF11935 SYMPK_PTA1_N	33	15.5	Symplekin/PTA1 N-terminal
3	PF13174 TPR_6	0.45	22.4	Tetratricopeptide repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000355961

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000327889	0.999	Integrator complex subunit 5
2	9606.ENSP00000414237	0.999	Integrator complex subunit 2
3	9606.ENSP00000430338	0.999	Integrator complex subunit 8
4	9606.ENSP00000445001	0.999	Integrator complex subunit 11
5	9606.ENSP00000385722	0.998	Integrator complex subunit 1
6	9606.ENSP00000429065	0.997	Integrator complex subunit 9
7	9606.ENSP00000434466	0.994	Integrator complex subunit 4
8	9606.ENSP00000310260	0.992	Integrator complex subunit 6
9	9606.ENSP00000261191	0.983	Integrator complex subunit 13
10	9606.ENSP00000381064	0.983	Integrator complex subunit 10
11	9606.ENSP00000318641	0.977	Integrator complex subunit 3
12	9606.ENSP00000415433	0.976	Integrator complex subunit 12
13	9606.ENSP00000408429	0.954	Integrator complex subunit 14
14	9606.ENSP00000370625	0.917	DNA-directed RNA polymerase II subunit RPB2
15	9606.ENSP00000418447	0.869	Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform
16	9606.ENSP00000476948	0.861	Putative RNA polymerase II subunit B1 CTD phosphatase RPAP2
17	9606.ENSP00000480158	0.856	DNA-directed RNA polymerase II subunit RPB1
18	9606.ENSP00000340220	0.835	Uncharacterized protein C7orf26
19	9606.ENSP00000359788	0.748	Integrator complex subunit 6-like
20	9606.ENSP00000282516	0.720	Nipped-B-like protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.995	organic substance metabolic process
GO:0044238	0.995	primary metabolic process
GO:0044237	0.995	cellular metabolic process
GO:0034660	0.989	ncRNA metabolic process
GO:0010467	0.988	gene expression
GO:0016073	0.983	snRNA metabolic process
GO:0016180	0.968	snRNA processing
GO:0050789	0.847	regulation of biological process
GO:0050794	0.781	regulation of cellular process
GO:0050896	0.415	response to stimulus
GO:0010564	0.354	regulation of cell cycle process
GO:1901987	0.332	regulation of cell cycle phase transition
GO:0006974	0.327	cellular response to DNA damage stimulus
GO:0009314	0.320	response to radiation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005654	1.000	nucleoplasm
GO:0043232	0.998	intracellular non-membrane-bounded organelle
GO:0140513	0.995	nuclear protein-containing complex
GO:0005694	0.992	chromosome
GO:0016604	0.992	nuclear body
GO:0016020	0.453	membrane
GO:0032039	0.436	integrator complex
GO:0005829	0.392	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]