StarFunc result for job id Q9NVI1

User Input

>input (1328 residues)
MDQKILSLAAEKTADKLQEFLQTLREGDLTNLLQNQAVKGKVAGALLRAIFKGSPCSEEA
GTLRRRKIYTCCIQLVESGDLQKEIASEIIGLLMLEAHHFPGPLLVELANEFISAVREGS
LVNGKSLELLPIILTALATKKENLAYGKGVLSGEECKKQLINTLCSGRWDQQYVIQLTSM
FKDVPLTAEEVEFVVEKALSMFSKMNLQEIPPLVYQLLVLSSKGSRKSVLEGIIAFFSAL
DKQHNEEQSGDELLDVVTVPSGELRHVEGTIILHIVFAIKLDYELGRELVKHLKVGQQGD
SNNNLSPFSIALLLSVTRIQRFQDQVLDLLKTSVVKSFKDLQLLQGSKFLQNLVPHRSYV
STMILEVVKNSVHSWDHVTQGLVELGFILMDSYGPKKVLDGKTIETSPSLSRMPNQHACK
LGANILLETFKIHEMIRQEILEQVLNRVVTRASSPISHFLDLLSNIVMYAPLVLQSCSSK
VTEAFDYLSFLPLQTVQRLLKAVQPLLKVSMSMRDCLILVLRKAMFANQLDARKSAVAGF
LLLLKNFKVLGSLSSSQCSQSLSVSQVHVDVHSHYNSVANETFCLEIMDSLRRCLSQQAD
VRLMLYEGFYDVLRRNSQLANSVMQTLLSQLKQFYEPKPDLLPPLKLEACILTQGDKISL
QEPLDYLLCCIQHCLAWYKNTVIPLQQGEEEEEEEEAFYEDLDDILESITNRMIKSELED
FELDKSADFSQSTSIGIKNNICAFLVMGVCEVLIEYNFSISSFSKNRFEDILSLFMCYKK
LSDILNEKAGKAKTKMANKTSDSLLSMKFVSSLLTALFRDSIQSHQESLSVLRSSNEFMR
YAVNVALQKVQQLKETGHVSGPDGQNPEKIFQNLCDITRVLLWRYTSIPTSVEESGKKEK
GKSISLLCLEGLQKIFSAVQQFYQPKIQQFLRALDVTDKEGEEREDADVSVTQRTAFQIR
QFQRSLLNLLSSQEEDFNSKEALLLVTVLTSLSKLLEPSSPQFVQMLSWTSKICKENSRE
DALFCKSLMNLLFSLHVSYKSPVILLRDLSQDIHGHLGDIDQDVEVEKTNHFAIVNLRTA
APTVCLLVLSQAEKVLEEVDWLITKLKGQVSQETLSEEASSQATLPNQPVEKAIIMQLGT
LLTFFHELVQTALPSGSCVDTLLKDLCKMYTTLTALVRYYLQVCQSSGGIPKNMEKLVKL
SGSHLTPLCYSFISYVQNKSKSLNYTGEKKEKPAAVATAMARVLRETKPIPNLIFAIEQY
EKFLIHLSKKSKVNLMQHMKLSTSRDFKIKGNILDMVLREDGEDENEEGTASEHGGQNKE
PAKKKRKK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	PDB:6vaeA	0.878	0.972	0.000	1198	0.892	0.989	6vaeA.pdb.gz	DNA clamp function of the monoubiquitinated Fanconi anaemia ID complex.
2	AFDB:Q9NVI1	1.000	1.000	0.000	1328	1.000	1.000	Q9NVI1.pdb.gz	FANCI_HUMAN Fanconi anemia group I protein OS=Homo sapiens OX=9606 GN=FANCI PE=1 SV=4
3	PDB:7ay1A	0.744	0.950	2.312E-91	1033	0.776	0.997	7ay1A.pdb.gz	Structural basis of FANCD2 deubiquitination by USP1-UAF1.
4	PDB:8a2qB	0.776	0.944	6.779E-76	1084	0.571	0.699	8a2qB.pdb.gz
5	PDB:6tnfB	0.673	0.868	1.369E-52	1014	0.524	0.686	6tnfB.pdb.gz
6	PDB:6tngB	0.678	0.855	3.417E-51	1033	0.521	0.670	6tngB.pdb.gz
7	AFDB:Q54BR4	0.627	0.485	1.244E-40	1784	0.222	0.165	Q54BR4.pdb.gz	Q54BR4_DICDI Fanconi anemia group I protein homolog OS=Dictyostelium discoideum OX=44689 GN=DDB_G0293476 PE=4 SV=1
8	AFDB:F4K4R1	0.742	0.676	1.326E-39	1470	0.225	0.203	F4K4R1.pdb.gz	F4K4R1_ARATH Fanconi anemia group I-like protein OS=Arabidopsis thaliana OX=3702 GN=At5g49110 PE=1 SV=1
9	AFDB:Q80V62	0.468	0.435	3.253E-17	1450	0.123	0.113	Q80V62.pdb.gz	FACD2_MOUSE Fanconi anemia group D2 protein homolog OS=Mus musculus OX=10090 GN=Fancd2 PE=1 SV=2
10	AFDB:B3DJT4	0.481	0.449	8.200E-17	1445	0.131	0.120	B3DJT4.pdb.gz	B3DJT4_DANRE FA complementation group D2 OS=Danio rerio OX=7955 GN=fancd2 PE=1 SV=1
11	AFDB:Q9BXW9	0.524	0.487	9.866E-17	1451	0.136	0.124	Q9BXW9.pdb.gz	FACD2_HUMAN Fanconi anemia group D2 protein OS=Homo sapiens OX=9606 GN=FANCD2 PE=1 SV=2
12	PDB:7kzvV	0.448	0.500	8.893E-16	1155	0.120	0.138	7kzvV.pdb.gz	Structure of the FA core ubiquitin ligase closing the ID clamp on DNA.
13	AFDB:F4JIJ1	0.414	0.381	1.176E-15	1484	0.138	0.123	F4JIJ1.pdb.gz	F4JIJ1_ARATH Fanconi anemia group D2 protein OS=Arabidopsis thaliana OX=3702 GN=ATFANCD2 PE=1 SV=2
14	AFDB:Q8MYL1	0.450	0.414	3.403E-14	1478	0.127	0.114	Q8MYL1.pdb.gz	FACD2_DROME Fanconi anemia group D2 protein homolog OS=Drosophila melanogaster OX=7227 GN=Fancd2 PE=1 SV=1
15	PDB:3s4wB	0.439	0.491	9.746E-14	1146	0.117	0.136	3s4wB.pdb.gz
16	PDB:7zf1B	0.463	0.509	1.310E-13	1179	0.137	0.154	7zf1B.pdb.gz
17	AFDB:Q9U2H4	0.420	0.396	1.917E-12	1440	0.114	0.106	Q9U2H4.pdb.gz	Q9U2H4_CAEEL FANCD2 OS=Caenorhabditis elegans OX=6239 GN=fcd-2 PE=1 SV=3
18	PDB:6x9oA	0.143	0.097	3.297E-9	2425	0.133	0.073	6x9oA.pdb.gz
19	AFDB:O00410	0.136	0.157	3.491E-9	1097	0.105	0.127	O00410.pdb.gz	IPO5_HUMAN Importin-5 OS=Homo sapiens OX=9606 GN=IPO5 PE=1 SV=4
20	PDB:7jq9A	0.133	0.091	1.344E-8	2427	0.160	0.088	7jq9A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B0I564	0.0	1781	1338	0.675	0.670	B0I564_CHICK Fanconi anemia complementation group I OS=Gallus gallus OX=9031 GN=FANCI PE=1 SV=1
2	H3BP78	0.0	2062	1090	0.812	0.990	H3BP78_HUMAN FA complementation group I (Fragment) OS=Homo sapiens OX=9606 GN=FANCI PE=1 SV=1
3	Q9NVI1	0.0	2709	1328	1.000	1.000	FANCI_HUMAN Fanconi anemia group I protein OS=Homo sapiens OX=9606 GN=FANCI PE=1 SV=4
4	F4K4R1	1.10e-48	192	1470	0.120	0.109	F4K4R1_ARATH Fanconi anemia group I-like protein OS=Arabidopsis thaliana OX=3702 GN=At5g49110 PE=1 SV=1
5	Q54BR4	1.01e-37	157	1784	0.097	0.072	Q54BR4_DICDI Fanconi anemia group I protein homolog OS=Dictyostelium discoideum OX=44689 GN=DDB_G0293476 PE=4 SV=1
6	Q386C3	1.9	35.4	1108	0.041	0.049	Q386C3_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.1410 PE=4 SV=1
7	Q9Y4U1	3.0	34.3	282	0.016	0.074	MMAC_HUMAN Cyanocobalamin reductase / alkylcobalamin dealkylase OS=Homo sapiens OX=9606 GN=MMACHC PE=1 SV=3
8	Q9XUU8	4.7	33.9	686	0.019	0.036	Q9XUU8_CAEEL WD_REPEATS_REGION domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=CELE_K05C4.5 PE=1 SV=3
9	A0A0S2Z364	5.4	33.5	420	0.016	0.050	A0A0S2Z364_HUMAN Chloride channel 2 isoform 3 (Fragment) OS=Homo sapiens OX=9606 GN=CLCN2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06210 DUF1003	5.5e+02	12.1	Protein of unknown function (DUF1003)
2	PF13033 DUF3894	1.7e+02	13.7	Protein of unknown function (DUF3894)
3	PF13118 DUF3972	8.5e+02	11.8	Protein of unknown function (DUF3972)
4	PF14679 FANCI_HD1	1.5e-27	106.7	FANCI helical domain 1
5	PF14680 FANCI_HD2	3.4e-86	299.9	FANCI helical domain 2
6	PF14675 FANCI_S1	2e-74	261.4	FANCI solenoid 1
7	PF14674 FANCI_S1-cap	4.3e-22	89.1	FANCI solenoid 1 cap
8	PF14676 FANCI_S2	1.3e-59	212.4	FANCI solenoid 2
9	PF14677 FANCI_S3	7.6e-78	272.6	FANCI solenoid 3
10	PF14678 FANCI_S4	8.3e-100	344.6	FANCI solenoid 4
11	PF00834 Ribul_P_3_epim	4.1e+02	11.8	Ribulose-phosphate 3 epimerase family
12	PF13877 RPAP3_C	9.3e+02	11.9	Potential Monad-binding region of RPAP3
13	PF09325 Vps5	16	16.5	Vps5 C terminal like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000310842

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000287647	0.999	Fanconi anemia group D2 protein
2	9606.ENSP00000385021	0.999	E3 ubiquitin-protein ligase FANCL
3	9606.ENSP00000418960	0.998	Breast cancer type 1 susceptibility protein
4	9606.ENSP00000356243	0.997	Ubiquitin-conjugating enzyme E2 T
5	9606.ENSP00000369497	0.996	Breast cancer type 2 susceptibility protein
6	9606.ENSP00000307491	0.995	WD repeat-containing protein 48
7	9606.ENSP00000343526	0.995	Ubiquitin carboxyl-terminal hydrolase 1
8	9606.ENSP00000373952	0.995	Fanconi anemia group A protein
9	9606.ENSP00000367910	0.994	Fanconi anemia group G protein
10	9606.ENSP00000229769	0.993	Fanconi anemia group E protein
11	9606.ENSP00000381378	0.993	Fanconi anemia group B protein
12	9606.ENSP00000289081	0.992	Fanconi anemia group C protein
13	9606.ENSP00000330875	0.992	Fanconi anemia group F protein
14	9606.ENSP00000333283	0.992	Fanconi anemia core complex-associated protein 100
15	9606.ENSP00000261584	0.990	Partner and localizer of BRCA2
16	9606.ENSP00000278616	0.990	Serine-protein kinase ATM
17	9606.ENSP00000354497	0.989	Fanconi-associated nuclease 1
18	9606.ENSP00000388648	0.989	Serine/threonine-protein kinase Chk1
19	9606.ENSP00000267430	0.985	Fanconi anemia group M protein
20	9606.ENSP00000376272	0.983	Replication factor C subunit 4

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0070182	1.000	DNA polymerase binding
GO:0003824	0.325	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050789	0.993	regulation of biological process
GO:0019222	0.905	regulation of metabolic process
GO:0080090	0.901	regulation of primary metabolic process
GO:0060255	0.900	regulation of macromolecule metabolic process
GO:0051171	0.900	regulation of nitrogen compound metabolic process
GO:0048518	0.883	positive regulation of biological process
GO:0051173	0.811	positive regulation of nitrogen compound metabolic process
GO:0031398	0.799	positive regulation of protein ubiquitination
GO:0050794	0.653	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005829	0.989	cytosol
GO:0032991	0.971	protein-containing complex
GO:0016020	0.925	membrane
GO:0043232	0.886	intracellular non-membrane-bounded organelle
GO:1902494	0.763	catalytic complex
GO:0140513	0.540	nuclear protein-containing complex
GO:0005694	0.469	chromosome
GO:1990391	0.370	DNA repair complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]