StarFunc result for job id Q9NVN8

User Input

>input (582 residues)
MMKLRHKNKKPGEGSKGHKKISWPYPQPAKQNGKKATSKVPSAPHFVHPNDHANREAELK
KKWVEEMREKQQAAREQERQKRRTIESYCQDVLRRQEEFEHKEEVLQELNMFPQLDDEAT
RKAYYKEFRKVVEYSDVILEVLDARDPLGCRCFQMEEAVLRAQGNKKLVLVLNKIDLVPK
EVVEKWLDYLRNELPTVAFKASTQHQVKNLNRCSVPVDQASESLLKSKACFGAENLMRVL
GNYCRLGEVRTHIRVGVVGLPNVGKSSLINSLKRSRACSVGAVPGITKFMQEVYLDKFIR
LLDAPGIVPGPNSEVGTILRNCVHVQKLADPVTPVETILQRCNLEEISNYYGVSGFQTTE
HFLTAVAHRLGKKKKGGLYSQEQAAKAVLADWVSGKISFYIPPPATHTLPTHLSAEIVKE
MTEVFDIEDTEQANEDTMECLATGESDELLGDTDPLEMEIKLLHSPMTKIADAIENKTTV
YKIGDLTGYCTNPNRHQMGWAKRNVDHRPKSNSMVDVCSVDRRSVLQRIMETDPLQQGQA
LASALKNKKKMQKRADKIASKLSDSMMSALDLSGNADDGVGD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R9Y6	0.573	0.573	1.268E-88	582	1.000	1.000	A0A024R9Y6.pdb.gz
2	AFDB:Q6DBQ5	0.550	0.561	2.513E-52	571	0.460	0.469	Q6DBQ5.pdb.gz
3	AFDB:Q21086	0.529	0.554	7.830E-41	556	0.342	0.358	Q21086.pdb.gz	GNL3_CAEEL Guanine nucleotide-binding protein-like 3 homolog OS=Caenorhabditis elegans OX=6239 GN=nst-1 PE=3 SV=1
4	AFDB:Q9M8Z5	0.535	0.535	1.817E-38	582	0.308	0.308	Q9M8Z5.pdb.gz	NSN1_ARATH Guanine nucleotide-binding protein-like NSN1 OS=Arabidopsis thaliana OX=3702 GN=NSN1 PE=1 SV=1
5	AFDB:Q8MT06	0.545	0.546	1.403E-36	581	0.338	0.339	Q8MT06.pdb.gz	GNL3_DROME Guanine nucleotide-binding protein-like 3 homolog OS=Drosophila melanogaster OX=7227 GN=Ns1 PE=1 SV=2
6	AFDB:Q6DRP2	0.507	0.526	1.451E-32	561	0.265	0.275	Q6DRP2.pdb.gz	GNL3_DANRE Guanine nucleotide-binding protein-like 3 OS=Danio rerio OX=7955 GN=gnl3 PE=2 SV=1
7	AFDB:Q9BVP2	0.497	0.526	2.380E-32	549	0.290	0.308	Q9BVP2.pdb.gz	GNL3_HUMAN Guanine nucleotide-binding protein-like 3 OS=Homo sapiens OX=9606 GN=GNL3 PE=1 SV=2
8	AFDB:Q8CI11	0.499	0.539	8.507E-31	538	0.290	0.314	Q8CI11.pdb.gz	GNL3_MOUSE Guanine nucleotide-binding protein-like 3 OS=Mus musculus OX=10090 GN=Gnl3 PE=1 SV=2
9	AFDB:Q811S9	0.495	0.535	1.120E-30	538	0.282	0.305	Q811S9.pdb.gz	GNL3_RAT Guanine nucleotide-binding protein-like 3 OS=Rattus norvegicus OX=10116 GN=Gnl3 PE=1 SV=1
10	AFDB:Q9C923	0.442	0.446	1.853E-29	576	0.218	0.220	Q9C923.pdb.gz	NUG2_ARATH Nuclear/nucleolar GTPase 2 OS=Arabidopsis thaliana OX=3702 GN=NUG2 PE=1 SV=1
11	PDB:6n8jm	0.424	0.644	1.845E-22	378	0.180	0.278	6n8jm.pdb.gz	Tightly-orchestrated rearrangements govern catalytic center assembly of the ribosome.
12	PDB:7btbm	0.438	0.540	2.318E-21	469	0.189	0.235	7btbm.pdb.gz	Structural insights into assembly of the ribosomal nascent polypeptide exit tunnel.
13	PDB:5t62W	0.408	0.752	1.543E-17	306	0.139	0.265	5t62W.pdb.gz	Nmd3 is a structural mimic of eIF5A, and activates the cpGTPase Lsg1 during 60S ribosome biogenesis.
14	PDB:6n8nW	0.396	0.591	3.580E-15	377	0.148	0.228	6n8nW.pdb.gz	Tightly-orchestrated rearrangements govern catalytic center assembly of the ribosome.
15	PDB:1pujA	0.349	0.729	1.671E-14	261	0.110	0.245	1pujA.pdb.gz	Structure of the YlqF GTPase from B. subtilis
16	PDB:7of1m	0.294	0.732	5.022E-14	229	0.122	0.310	7of1m.pdb.gz	Analysis of subunit folding contribution of three yeast large ribosomal subunit proteins required for stabilisation and processing of intermediate nuclear rRNA precursors.
17	PDB:6qtzo	0.388	0.668	5.924E-14	325	0.146	0.262	6qtzo.pdb.gz	Mechanism of completion of peptidyltransferase centre assembly in eukaryotes.
18	PDB:7pd3z	0.381	0.688	2.383E-11	311	0.132	0.248	7pd3z.pdb.gz	Visualizing formation of the active site in the mitochondrial ribosome.
19	PDB:6yxyEM	0.323	0.526	1.742E-9	330	0.103	0.182	6yxyEM.pdb.gz	Structural Insights into the Mechanism of Mitoribosomal Large Subunit Biogenesis.
20	PDB:7o9kC	0.317	0.666	8.590E-9	255	0.124	0.282	7o9kC.pdb.gz	Structural basis for late maturation steps of the human mitoribosomal large subunit.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9NVN8	0.0	1216	582	1.000	1.000	GNL3L_HUMAN Guanine nucleotide-binding protein-like 3-like protein OS=Homo sapiens OX=9606 GN=GNL3L PE=1 SV=1
2	Q7SZX9	1.14e-169	495	565	0.491	0.506	Q7SZX9_DANRE Guanine nucleotide-binding protein-like 3 OS=Danio rerio OX=7955 GN=SI:zK13A21.8 PE=1 SV=1
3	Q9M8Z5	5.14e-99	314	582	0.306	0.306	NSN1_ARATH Guanine nucleotide-binding protein-like NSN1 OS=Arabidopsis thaliana OX=3702 GN=NSN1 PE=1 SV=1
4	Q21086	1.32e-97	310	556	0.359	0.376	GNL3_CAEEL Guanine nucleotide-binding protein-like 3 homolog OS=Caenorhabditis elegans OX=6239 GN=nst-1 PE=3 SV=1
5	Q8MT06	3.12e-97	310	581	0.309	0.310	GNL3_DROME Guanine nucleotide-binding protein-like 3 homolog OS=Drosophila melanogaster OX=7227 GN=Ns1 PE=1 SV=2
6	Q9BVP2	2.20e-87	283	549	0.275	0.291	GNL3_HUMAN Guanine nucleotide-binding protein-like 3 OS=Homo sapiens OX=9606 GN=GNL3 PE=1 SV=2
7	Q8CI11	2.17e-79	261	538	0.277	0.299	GNL3_MOUSE Guanine nucleotide-binding protein-like 3 OS=Mus musculus OX=10090 GN=Gnl3 PE=1 SV=2
8	Q6DRP2	9.69e-75	250	561	0.289	0.299	GNL3_DANRE Guanine nucleotide-binding protein-like 3 OS=Danio rerio OX=7955 GN=gnl3 PE=2 SV=1
9	Q811S9	2.36e-70	238	538	0.270	0.292	GNL3_RAT Guanine nucleotide-binding protein-like 3 OS=Rattus norvegicus OX=10116 GN=Gnl3 PE=1 SV=1
10	O14236	6.62e-58	204	537	0.196	0.212	NOG2_SCHPO Nucleolar GTP-binding protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=nog2 PE=1 SV=1
11	Q386P6	1.46e-53	191	486	0.225	0.270	Q386P6_TRYB2 GTP-binding protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.02.0240 PE=4 SV=1
12	Q7JXU4	4.57e-53	194	674	0.182	0.157	Q7JXU4_DROME Nucleolar GTP-binding protein 2 OS=Drosophila melanogaster OX=7227 GN=Ns2 PE=1 SV=1
13	O74791	1.54e-52	188	470	0.227	0.281	GRN1_SCHPO GTPase grn1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=grn1 PE=1 SV=1
14	Q7SZQ9	8.20e-52	191	727	0.177	0.142	Q7SZQ9_DANRE Nucleolar GTP-binding protein 2 OS=Danio rerio OX=7955 GN=zgc:65800 PE=1 SV=1
15	P53742	2.26e-51	186	486	0.172	0.206	NOG2_YEAST Nucleolar GTP-binding protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NOG2 PE=1 SV=1
16	Q13823	5.71e-51	189	731	0.191	0.152	NOG2_HUMAN Nucleolar GTP-binding protein 2 OS=Homo sapiens OX=9606 GN=GNL2 PE=1 SV=1
17	Q5T0F3	5.71e-51	189	731	0.191	0.152	Q5T0F3_HUMAN Nucleolar GTP-binding protein 2 OS=Homo sapiens OX=9606 GN=GNL2 PE=2 SV=1
18	Q9C923	9.50e-51	186	576	0.175	0.177	NUG2_ARATH Nuclear/nucleolar GTPase 2 OS=Arabidopsis thaliana OX=3702 GN=NUG2 PE=1 SV=1
19	Q57TY2	6.33e-50	184	601	0.184	0.178	Q57TY2_TRYB2 Nucleolar GTP-binding protein 2 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.30D13.330 PE=3 SV=1
20	P40010	1.13e-49	182	520	0.196	0.219	NUG1_YEAST Nuclear GTP-binding protein NUG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NUG1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF19993 DO-GTPase2	10	17.4	Double-GTPase 2
2	PF00350 Dynamin_N	2.5e+02	13.1	Dynamin family
3	PF02421 FeoB_N	6e-06	37.3	Ferrous iron transport protein B
4	PF00009 GTP_EFTU	0.81	20.7	Elongation factor Tu GTP binding domain
5	PF01926 MMR_HSR1	1.9e-12	58.6	50S ribosome-binding GTPase
6	PF03193 RsgA_GTPase	0.043	25.2	RsgA GTPase
7	PF08644 SPT16	2.5e+02	13.3	FACT complex subunit (SPT16/CDC68)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000338573

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000362153	0.993	Nucleolar GTP-binding protein 2
2	9606.ENSP00000354040	0.992	Nucleolar GTP-binding protein 1
3	9606.ENSP00000358563	0.989	H/ACA ribonucleoprotein complex subunit 4
4	9606.ENSP00000396673	0.988	pre-rRNA processing protein FTSJ3
5	9606.ENSP00000346725	0.984	Pescadillo homolog
6	9606.ENSP00000285814	0.975	Nucleolar protein interacting with the FHA domain of MKI67
7	9606.ENSP00000360412	0.974	Nucleolar complex protein 3 homolog
8	9606.ENSP00000413572	0.973	Notchless protein homolog 1
9	9606.ENSP00000483484	0.973	Ribosome biogenesis protein NSA2 homolog
10	9606.ENSP00000455106	0.972	Ribosome biogenesis protein BOP1
11	9606.ENSP00000402338	0.971	Ribosome production factor 2 homolog
12	9606.ENSP00000348596	0.969	Protein SDA1 homolog
13	9606.ENSP00000364320	0.968	mRNA turnover protein 4 homolog
14	9606.ENSP00000238146	0.966	ATP-dependent RNA helicase DDX55
15	9606.ENSP00000371858	0.966	Probable 28S rRNA (cytosine(4447)-C(5))-methyltransferase
16	9606.ENSP00000460871	0.966	Ribosomal L1 domain-containing protein 1
17	9606.ENSP00000263239	0.962	ATP-dependent RNA helicase DDX18
18	9606.ENSP00000257829	0.959	RNA cytidine acetyltransferase
19	9606.ENSP00000323858	0.959	ATP-dependent RNA helicase DDX54
20	9606.ENSP00000253237	0.957	Glutamate-rich WD repeat-containing protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0003723	0.997	RNA binding
GO:0003824	0.926	catalytic activity
GO:0016462	0.672	pyrophosphatase activity
GO:0017111	0.662	ribonucleoside triphosphate phosphatase activity
GO:0003924	0.600	GTPase activity
GO:0003729	0.304	mRNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.970	regulation of cellular process
GO:0009987	0.958	cellular process
GO:0033044	0.935	regulation of chromosome organization
GO:0032204	0.896	regulation of telomere maintenance
GO:2000278	0.865	regulation of DNA biosynthetic process
GO:1904356	0.864	regulation of telomere maintenance via telomere lengthening
GO:0032210	0.840	regulation of telomere maintenance via telomerase
GO:0048519	0.831	negative regulation of biological process
GO:0008152	0.805	metabolic process
GO:0071704	0.803	organic substance metabolic process
GO:0048523	0.796	negative regulation of cellular process
GO:0044238	0.778	primary metabolic process
GO:0051053	0.765	negative regulation of DNA metabolic process
GO:0006807	0.760	nitrogen compound metabolic process
GO:0044237	0.759	cellular metabolic process
GO:0043170	0.720	macromolecule metabolic process
GO:0048518	0.676	positive regulation of biological process
GO:0034641	0.670	cellular nitrogen compound metabolic process
GO:0051129	0.509	negative regulation of cellular component organization
GO:2000279	0.487	negative regulation of DNA biosynthetic process
GO:0048522	0.485	positive regulation of cellular process
GO:0071840	0.465	cellular component organization or biogenesis
GO:0010467	0.456	gene expression
GO:0006139	0.456	nucleobase-containing compound metabolic process
GO:0090304	0.365	nucleic acid metabolic process
GO:0016070	0.344	RNA metabolic process
GO:0042254	0.326	ribosome biogenesis
GO:1903320	0.303	regulation of protein modification by small protein conjugation or removal

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005730	1.000	nucleolus
GO:0005829	0.996	cytosol
GO:0032991	0.912	protein-containing complex
GO:0016020	0.850	membrane
GO:1990904	0.683	ribonucleoprotein complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.6.1.-	0.672	In phosphorus-containing anhydrides.
RHEA:23680	0.662	a ribonucleoside 5'-triphosphate + H2O = a ribonucleoside 5'-diphosphate + H(+) + phosphate
EC:3.6.1.15	0.662	nucleoside-triphosphate phosphatase.
RHEA:19669	0.600	GTP + H2O = GDP + H(+) + phosphate

[back to server]