StarFunc result for job id Q9NVP4

User Input

>input (752 residues)
MTAGSVCVPQIIPLRVPQPGKANHEIDNNTLLEMKSDTPDVNIYYTLDGSKPEFLKRIGY
GENNTFKYIKPITLPDGKIQVKAIAVSKDCRQSGIVTKVFHVDYEPPNIVSPEDNVENVL
KDSSRQEFKNGFVGSKLKKKYKNSENQRSWNVNLRKFPESPLEIPAYGGGSGSRPPTRQS
QSPGFAHVSGQKCLTSTEIMRIQRETDFLKCAHCLAPRPSDPFARFCQECGSPVPPIFGC
RLPPPEGAQMGLCAECRSLVPMNTPICVVCEAPLALQLQPQASLHLKEKVICRACGTGNP
AHLRYCVTCEGALPSSQESMCSGDKAPPPPTQKGGTISCYRCGRWNLWEASFCGWCGAML
GIPAGCSVCPKCGASNHLSARFCGSCGICVKSLVKLSLDRSLALAAEEPRPFSESLNIPL
PRSDVGTKRDIGTQTVGLFYPSGKLLAKKEQELASQKQRQEKMSDHKPLLTAISPGRGYW
RRQLDHISAHLRCYAQNNPEFRALIAEPRMGKLISATVHEDGCEVSIRLNYSQVSNKNLY
LNKAVNFSDHLLSSAAEGDGGLCGSRSSWVSDYSQSTSDTIEKIKRIKNFKTKTFQEKKE
QLIPENRLLLKEVGPTGEGRVSVIEQLLDEGADPNCCDEDNRPVITVAVMNKHHEAIPVL
VQRGADIDQQWGPLRNTALHEATLLGLAGRESTATLLGCNASIQKKNAGGQTAYDLALNT
GDDLVTSLFAAKFGQGLEDQLAQTRSLSLDDC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q1LXR6	0.253	0.253	2.598E-77	752	0.479	0.479	Q1LXR6.pdb.gz	DZAN1_DANRE Double zinc ribbon and ankyrin repeat-containing protein 1 OS=Danio rerio OX=7955 GN=dzank1 PE=2 SV=1
2	PDB:3ehqA	0.142	0.536	1.841E-5	182	0.039	0.159	3ehqA.pdb.gz
3	PDB:6jd6B	0.134	0.472	2.440E-5	192	0.041	0.161	6jd6B.pdb.gz
4	AFDB:Q5H9F3	0.130	0.059	2.706E-5	1711	0.144	0.063	Q5H9F3.pdb.gz	BCORL_HUMAN BCL-6 corepressor-like protein 1 OS=Homo sapiens OX=9606 GN=BCORL1 PE=1 SV=2
5	PDB:1bd8A	0.136	0.606	2.890E-5	156	0.036	0.173	1bd8A.pdb.gz
6	AFDB:F1QWN1	0.154	0.111	4.493E-5	1063	0.149	0.105	F1QWN1.pdb.gz	F1QWN1_DANRE Tumor protein p53 binding protein, 2 isoform X1 OS=Danio rerio OX=7955 GN=si:dkeyp-34c12.2 PE=4 SV=2
7	PDB:7df7B	0.147	0.827	6.010E-5	119	0.033	0.210	7df7B.pdb.gz
8	PDB:8cs9A	0.151	0.143	7.116E-5	796	0.040	0.038	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
9	PDB:6mwqA	0.132	0.198	7.529E-5	493	0.039	0.059	6mwqA.pdb.gz
10	AFDB:Q380Y7	0.086	0.066	1.736E-4	1004	0.059	0.044	Q380Y7.pdb.gz	Q380Y7_TRYB2 AMP-activated protein kinase glycogen-binding domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.8770 PE=4 SV=1
11	PDB:1bu9A	0.131	0.454	1.961E-4	168	0.044	0.196	1bu9A.pdb.gz
12	PDB:6pqpA	0.149	0.180	2.323E-4	615	0.037	0.046	6pqpA.pdb.gz	Structural Insights into Electrophile Irritant Sensing by the Human TRPA1 Channel.
13	PDB:2dvwA	0.147	0.456	2.750E-4	229	0.037	0.122	2dvwA.pdb.gz
14	PDB:4oauC	0.145	0.156	3.256E-4	692	0.039	0.042	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
15	AFDB:F1M5H6	0.150	0.102	9.953E-4	1128	0.148	0.098	F1M5H6.pdb.gz	F1M5H6_RAT Tumor protein p53 binding protein, 2 OS=Rattus norvegicus OX=10116 GN=Tp53bp2 PE=1 SV=2
16	AFDB:F1QBD4	0.083	0.049	3.846E-3	1387	0.110	0.060	F1QBD4.pdb.gz
17	AFDB:Q6W2J9	0.140	0.065	4.818E-3	1755	0.122	0.052	Q6W2J9.pdb.gz	BCOR_HUMAN BCL-6 corepressor OS=Homo sapiens OX=9606 GN=BCOR PE=1 SV=1
18	AFDB:Q9VZT8	0.080	0.048	4.818E-3	1443	0.128	0.067	Q9VZT8.pdb.gz	Q9VZT8_DROME Myomesin and myosin binding protein OS=Drosophila melanogaster OX=7227 GN=MnM PE=4 SV=3
19	AFDB:Q9ET54	0.083	0.049	5.097E-3	1408	0.116	0.062	Q9ET54.pdb.gz	PALLD_MOUSE Palladin OS=Mus musculus OX=10090 GN=Palld PE=1 SV=2
20	AFDB:A8JUV7	0.081	0.059	5.393E-3	1105	0.112	0.076	A8JUV7.pdb.gz	A8JUV7_DROME Brother of ihog, isoform G OS=Drosophila melanogaster OX=7227 GN=boi PE=1 SV=3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q1LXR6	0.0	643	752	0.492	0.492	DZAN1_DANRE Double zinc ribbon and ankyrin repeat-containing protein 1 OS=Danio rerio OX=7955 GN=dzank1 PE=2 SV=1
2	A0A0S2Z6F4	1.75e-06	50.8	160	0.048	0.225	A0A0S2Z6F4_HUMAN Ankyrin repeat domain 50 isoform 2 OS=Homo sapiens OX=9606 GN=ANKRD50 PE=1 SV=1
3	Q9ULJ7	4.72e-05	49.7	1429	0.045	0.024	ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens OX=9606 GN=ANKRD50 PE=1 SV=4
4	A5WVX9	5.98e-05	48.9	620	0.048	0.058	ZDH17_DANRE Palmitoyltransferase ZDHHC17 OS=Danio rerio OX=7955 GN=zdhhc17 PE=2 SV=1
5	F6NJE0	9.99e-05	48.1	728	0.044	0.045	F6NJE0_DANRE Ankyrin repeat domain 6b OS=Danio rerio OX=7955 GN=ankrd6 PE=4 SV=1
6	Q8IUH5	1.42e-04	47.8	632	0.048	0.057	ZDH17_HUMAN Palmitoyltransferase ZDHHC17 OS=Homo sapiens OX=9606 GN=ZDHHC17 PE=1 SV=2
7	Q96Q27	1.94e-04	47.4	635	0.053	0.063	ASB2_HUMAN Ankyrin repeat and SOCS box protein 2 OS=Homo sapiens OX=9606 GN=ASB2 PE=1 SV=2
8	Q8NB46	2.28e-04	47.4	1076	0.048	0.033	ANR52_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Homo sapiens OX=9606 GN=ANKRD52 PE=1 SV=3
9	M9NFZ0	2.70e-04	46.2	341	0.047	0.103	M9NFZ0_DROME Myosin binding subunit, isoform P OS=Drosophila melanogaster OX=7227 GN=Mbs PE=1 SV=1
10	Q80TN5	3.32e-04	46.6	632	0.047	0.055	ZDH17_MOUSE Palmitoyltransferase ZDHHC17 OS=Mus musculus OX=10090 GN=Zdhhc17 PE=1 SV=2
11	Q86RA0	4.56e-04	46.2	927	0.047	0.038	Q86RA0_DROME Myosin phosphatase DMBS-L OS=Drosophila melanogaster OX=7227 GN=Mbs PE=2 SV=1
12	A8JNT4	4.67e-04	46.2	925	0.047	0.038	A8JNT4_DROME Myosin binding subunit, isoform H OS=Drosophila melanogaster OX=7227 GN=Mbs PE=1 SV=1
13	Q5XJ13	4.84e-04	46.2	739	0.044	0.045	ANKS6_DANRE Ankyrin repeat and SAM domain-containing protein 6 OS=Danio rerio OX=7955 GN=anks6 PE=2 SV=1
14	Q9VUW9	5.02e-04	45.8	637	0.041	0.049	HIP14_DROME Palmitoyltransferase Hip14 OS=Drosophila melanogaster OX=7227 GN=Hip14 PE=1 SV=1
15	M9NDS8	5.12e-04	46.2	1245	0.047	0.028	M9NDS8_DROME Myosin binding subunit, isoform N OS=Drosophila melanogaster OX=7227 GN=Mbs PE=1 SV=1
16	M9NEB2	5.18e-04	46.2	1273	0.047	0.027	M9NEB2_DROME Myosin binding subunit, isoform O OS=Drosophila melanogaster OX=7227 GN=Mbs PE=1 SV=1
17	Q91WK7	5.21e-04	45.1	299	0.044	0.110	ANR54_MOUSE Ankyrin repeat domain-containing protein 54 OS=Mus musculus OX=10090 GN=Ankrd54 PE=1 SV=1
18	M9NFF6	5.34e-04	46.2	1243	0.047	0.028	M9NFF6_DROME Myosin binding subunit, isoform M OS=Drosophila melanogaster OX=7227 GN=Mbs PE=1 SV=1
19	M9NDA1	5.52e-04	45.8	1230	0.047	0.028	M9NDA1_DROME Myosin binding subunit, isoform L OS=Drosophila melanogaster OX=7227 GN=Mbs PE=1 SV=1
20	Q9Y2G4	5.57e-04	45.8	727	0.043	0.044	ANKR6_HUMAN Ankyrin repeat domain-containing protein 6 OS=Homo sapiens OX=9606 GN=ANKRD6 PE=2 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	23	16.8	Ankyrin repeat
2	PF12796 Ank_2	0.03	26.2	Ankyrin repeats (3 copies)
3	PF13637 Ank_4	16	17.5	Ankyrin repeats (many copies)
4	PF13290 CHB_HEX_C_1	4.3e-09	47.6	Chitobiase/beta-hexosaminidase C-terminal domain
5	PF12773 DZR	9.5e-13	59.2	Double zinc ribbon
6	PF18912 DZR_2	13	17.1	Double zinc ribbon domain
7	PF13287 Fn3_assoc	2.1e-13	61.5	Fn3 associated
8	PF00641 zf-RanBP	9.6	16.9	Zn-finger in Ran binding protein and others
9	PF13240 zinc_ribbon_2	2.4	19.3	zinc-ribbon domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000262547

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000336866	0.712	Putative hydrolase RBBP9
2	9606.ENSP00000451162	0.672	Centrosomal protein 128
3	9606.ENSP00000257909	0.593	Tastin
4	9606.ENSP00000439427	0.546	Zinc finger protein 133
5	9606.ENSP00000257575	0.528	Ring finger protein, transmembrane 2
6	9606.ENSP00000455099	0.525	Transmembrane protein 88B
7	9606.ENSP00000359990	0.508	Leucine-rich repeat-containing protein 40
8	9606.ENSP00000482195	0.506	Zinc finger CCHC-type containing 18

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0097159	0.519	organic cyclic compound binding
GO:1901363	0.462	heterocyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.963	cellular process
GO:0032502	0.959	developmental process
GO:0032501	0.867	multicellular organismal process
GO:0030154	0.842	cell differentiation
GO:0048856	0.782	anatomical structure development
GO:0048731	0.663	system development
GO:0046530	0.593	photoreceptor cell differentiation
GO:0048513	0.587	animal organ development
GO:0048666	0.581	neuron development
GO:0009653	0.528	anatomical structure morphogenesis
GO:0009887	0.523	animal organ morphogenesis
GO:0090596	0.508	sensory organ morphogenesis
GO:0001654	0.505	eye development
GO:0065007	0.478	biological regulation
GO:0050789	0.439	regulation of biological process
GO:0050794	0.336	regulation of cellular process
GO:0048592	0.303	eye morphogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043226	1.000	organelle
GO:0005622	1.000	intracellular anatomical structure
GO:0043227	0.990	membrane-bounded organelle
GO:0043229	0.959	intracellular organelle
GO:0043232	0.817	intracellular non-membrane-bounded organelle
GO:0005929	0.773	cilium
GO:0005737	0.733	cytoplasm
GO:0005856	0.331	cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]