StarFunc result for job id Q9NVQ4

User Input

>input (179 residues)
MTDLVAVWDVALSDGVHKIEFEHGTTSGKRVVYVDGKEEIRKEWMFKLVGKETFYVGAAK
TKATINIDAISGFAYEYTLEINGKSLKKYMEDRSKTTNTWVLHMDGENFRIVLEKDAMDV
WCNGKKLETAGEFVDDGTETHFSIGNHDCYIKAVSSGKRKEGIIHTLIVDNREIPEIAS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8R5H8	0.970	0.865	4.770E-31	201	0.894	0.796	Q8R5H8.pdb.gz	FAIM1_RAT Fas apoptotic inhibitory molecule 1 OS=Rattus norvegicus OX=10116 GN=Faim PE=2 SV=1
2	AFDB:Q9VKJ3	0.208	0.039	1.731E-2	1411	0.123	0.016	Q9VKJ3.pdb.gz	NU160_DROME Nuclear pore complex protein Nup160 homolog OS=Drosophila melanogaster OX=7227 GN=Nup160 PE=1 SV=1
3	PDB:7snyA	0.249	0.277	2.413E-2	159	0.123	0.138	7snyA.pdb.gz
4	PDB:5hztA	0.207	0.197	2.538E-2	193	0.145	0.135	5hztA.pdb.gz	Crystal structures of Dronpa complexed with quenchable metal ions provide insight into metal biosensor development
5	AFDB:Q8N135	0.206	0.093	2.861E-2	537	0.128	0.043	Q8N135.pdb.gz	LGI4_HUMAN Leucine-rich repeat LGI family member 4 OS=Homo sapiens OX=9606 GN=LGI4 PE=1 SV=1
6	PDB:6xt9I	0.187	0.074	3.430E-2	767	0.089	0.021	6xt9I.pdb.gz
7	PDB:7snsC	0.235	0.243	3.430E-2	172	0.089	0.093	7snsC.pdb.gz
8	AFDB:Q9SR08	0.185	0.110	3.498E-2	390	0.095	0.044	Q9SR08.pdb.gz	FBK49_ARATH F-box/kelch-repeat protein At3g04660 OS=Arabidopsis thaliana OX=3702 GN=At3g04660 PE=1 SV=1
9	AFDB:Q16363	0.183	0.034	4.067E-2	1823	0.145	0.014	Q16363.pdb.gz	LAMA4_HUMAN Laminin subunit alpha-4 OS=Homo sapiens OX=9606 GN=LAMA4 PE=1 SV=4
10	AFDB:Q9GV45	0.244	0.226	4.067E-2	196	0.078	0.071	Q9GV45.pdb.gz	LUCI_OPLGR Oplophorus-luciferin 2-monooxygenase catalytic subunit OS=Oplophorus gracilirostris OX=727944 PE=1 SV=1
11	PDB:5aedA	0.217	0.064	4.637E-2	674	0.106	0.028	5aedA.pdb.gz	Yihq is a Sulfoquinovosidase that Cleaves Sulfoquinovosyl Diacylglyceride Sulfolipids.
12	AFDB:Q8K1S1	0.205	0.093	4.729E-2	537	0.123	0.041	Q8K1S1.pdb.gz	LGI4_MOUSE Leucine-rich repeat LGI family member 4 OS=Mus musculus OX=10090 GN=Lgi4 PE=1 SV=1
13	AFDB:Q9V4D9	0.163	0.113	4.972E-2	275	0.128	0.084	Q9V4D9.pdb.gz	Q9V4D9_DROME Purine-rich binding protein-alpha, isoform B OS=Drosophila melanogaster OX=7227 GN=Pur-alpha PE=3 SV=2
14	PDB:2j04A	0.179	0.070	5.391E-2	587	0.134	0.041	2j04A.pdb.gz
15	PDB:7r5jR0	0.206	0.041	5.391E-2	1399	0.106	0.014	7r5jR0.pdb.gz	AI-based structure prediction empowers integrative structural analysis of human nuclear pores
16	AFDB:Q93646	0.195	0.094	5.781E-2	440	0.101	0.041	Q93646.pdb.gz	SNT1_CAEEL Syntrophin-1 OS=Caenorhabditis elegans OX=6239 GN=stn-1 PE=1 SV=1
17	AFDB:O60157	0.197	0.083	6.079E-2	681	0.101	0.026	O60157.pdb.gz	TYW4_SCHPO tRNA wybutosine-synthesizing protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ppm2 PE=3 SV=1
18	PDB:7dvq3	0.183	0.043	7.663E-2	1193	0.145	0.022	7dvq3.pdb.gz	Structure of the activated human minor spliceosome.
19	PDB:6qk7A	0.189	0.049	8.910E-2	1161	0.151	0.023	6qk7A.pdb.gz	Molecular basis of tRNA recognition by the Elongator complex.
20	PDB:4fhnD	0.169	0.050	1.089E-1	977	0.078	0.014	4fhnD.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9NVQ4	8.79e-131	365	179	1.000	1.000	FAIM1_HUMAN Fas apoptotic inhibitory molecule 1 OS=Homo sapiens OX=9606 GN=FAIM PE=1 SV=1
2	Q8R5H8	3.31e-122	344	201	0.905	0.806	FAIM1_RAT Fas apoptotic inhibitory molecule 1 OS=Rattus norvegicus OX=10116 GN=Faim PE=2 SV=1
3	Q9WUD8	3.60e-120	338	179	0.899	0.899	FAIM1_MOUSE Fas apoptotic inhibitory molecule 1 OS=Mus musculus OX=10090 GN=Faim PE=1 SV=1
4	Q9DGP9	7.9	29.3	483	0.067	0.025	DDX25_XENLA ATP-dependent RNA helicase DDX25 OS=Xenopus laevis OX=8355 GN=deadsouth PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12566 DUF3748	1.3e+02	14.0	Protein of unknown function (DUF3748)
2	PF06905 FAIM1	7.4e-84	291.2	Fas apoptotic inhibitory molecule (FAIM1)
3	PF18853 LPD37	4e+02	11.9	Large polyvalent protein associated domain 37

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000342805

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000431418	0.914	High affinity nerve growth factor receptor
2	9606.ENSP00000358525	0.903	Beta-nerve growth factor
3	9606.ENSP00000360242	0.744	E3 ubiquitin-protein ligase XIAP
4	9606.ENSP00000310933	0.659	MAP kinase-activating death domain protein
5	9606.ENSP00000312107	0.642	UBX domain-containing protein 2A
6	9606.ENSP00000360913	0.642	Spermatogenesis-associated protein 6
7	9606.ENSP00000264451	0.621	Zinc transporter 9
8	9606.ENSP00000439467	0.616	Programmed cell death protein 2
9	9606.ENSP00000314380	0.596	Protein lifeguard 1
10	9606.ENSP00000378725	0.594	Kinectin
11	9606.ENSP00000236273	0.581	Pre-mRNA-splicing factor SYF2
12	9606.ENSP00000321951	0.548	Protein lifeguard 2
13	9606.ENSP00000430985	0.546	Ankyrin repeat domain-containing protein 6

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0042981	0.989	regulation of apoptotic process
GO:0048523	0.976	negative regulation of cellular process
GO:0009966	0.954	regulation of signal transduction
GO:0009987	0.938	cellular process
GO:0043066	0.908	negative regulation of apoptotic process
GO:1902041	0.905	regulation of extrinsic apoptotic signaling pathway via death domain receptors
GO:0048585	0.830	negative regulation of response to stimulus
GO:0048518	0.817	positive regulation of biological process
GO:0048522	0.813	positive regulation of cellular process
GO:0051716	0.807	cellular response to stimulus
GO:0023057	0.763	negative regulation of signaling
GO:0009968	0.660	negative regulation of signal transduction
GO:0007165	0.566	signal transduction
GO:2001234	0.566	negative regulation of apoptotic signaling pathway
GO:0050793	0.333	regulation of developmental process
GO:2001237	0.329	negative regulation of extrinsic apoptotic signaling pathway

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.998	cytoplasm
GO:0043226	0.972	organelle
GO:0043229	0.930	intracellular organelle
GO:0043227	0.880	membrane-bounded organelle
GO:0043231	0.737	intracellular membrane-bounded organelle
GO:0005829	0.471	cytosol
GO:0043232	0.345	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]