StarFunc result for job id Q9NVS9

User Input

>input (261 residues)
MTCWLRGVTATFGRPAEWPGYLSHLCGRSAAMDLGPMRKSYRGDREAFEETHLTSLDPVK
QFAAWFEEAVQCPDIGEANAMCLATCTRDGKPSARMLLLKGFGKDGFRFFTNFESRKGKE
LDSNPFASLVFYWEPLNRQVRVEGPVKKLPEEEAECYFHSRPKSSQIGAVVSHQSSVIPD
REYLRKKNEELEQLYQDQEVPKPKSWGGYVLYPQVMEFWQGQTNRLHDRIVFRRGLPTGD
SPLGPMTHRGEEDWLYERLAP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NVS9	1.000	1.000	1.919E-54	261	1.000	1.000	Q9NVS9.pdb.gz	PNPO_HUMAN Pyridoxine-5'-phosphate oxidase OS=Homo sapiens OX=9606 GN=PNPO PE=1 SV=1
2	AFDB:O88794	0.924	0.924	1.711E-49	261	0.897	0.897	O88794.pdb.gz	PNPO_RAT Pyridoxine-5'-phosphate oxidase OS=Rattus norvegicus OX=10116 GN=Pnpo PE=1 SV=1
3	PDB:1nrgA	0.802	0.980	5.945E-42	213	0.816	1.000	1nrgA.pdb.gz	Structure and properties of recombinant human pyridoxine 5'-phosphate oxidase.
4	AFDB:Q1PCB0	0.864	0.877	3.540E-33	257	0.460	0.467	Q1PCB0.pdb.gz	PNPO_BOMMO Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Bombyx mori OX=7091 GN=PNPO PE=1 SV=1
5	AFDB:Q9VHZ5	0.847	0.898	5.083E-30	246	0.398	0.423	Q9VHZ5.pdb.gz	Q9VHZ5_DROME pyridoxal 5'-phosphate synthase OS=Drosophila melanogaster OX=7227 GN=sgll PE=1 SV=3
6	AFDB:Q9LTX3	0.796	0.395	2.053E-29	530	0.437	0.215	Q9LTX3.pdb.gz	PPOX1_ARATH Pyridoxine/pyridoxamine 5'-phosphate oxidase 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PPOX1 PE=1 SV=1
7	AFDB:Q9UTQ1	0.779	0.875	3.390E-25	231	0.375	0.424	Q9UTQ1.pdb.gz	PDX3_SCHPO Probable pyridoxamine 5'-phosphate oxidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC1093.02 PE=3 SV=1
8	PDB:1ci0A	0.732	0.925	7.909E-25	205	0.314	0.400	1ci0A.pdb.gz	The Structure of PNP Oxidase from S. Cerevisiae
9	PDB:1jnwA	0.769	0.932	2.253E-24	214	0.330	0.402	1jnwA.pdb.gz	Active site structure and stereospecificity of Escherichia coli pyridoxine-5'-phosphate oxidase.
10	AFDB:P38075	0.754	0.859	2.595E-24	228	0.333	0.382	P38075.pdb.gz	PDX3_YEAST Pyridoxamine 5'-phosphate oxidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PDX3 PE=1 SV=1
11	AFDB:P0AFI7	0.771	0.919	6.208E-24	218	0.330	0.394	P0AFI7.pdb.gz	PDXH_ECOLI Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Escherichia coli (strain K12) OX=83333 GN=pdxH PE=1 SV=2
12	AFDB:P9WIJ1	0.737	0.853	2.721E-22	224	0.322	0.375	P9WIJ1.pdb.gz	PDXH_MYCTU Pyridoxine 5'-phosphate oxidase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=pdxH PE=1 SV=1
13	PDB:2a2jA	0.657	0.836	1.519E-21	203	0.291	0.374	2a2jA.pdb.gz
14	AFDB:Q820A5	0.719	0.865	4.239E-18	215	0.261	0.316	Q820A5.pdb.gz	Q820A5_PSEAE Probable pyridoxamine 5'-phosphate oxidase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=phzG2 PE=3 SV=1
15	PDB:1t9mA	0.708	0.897	4.382E-18	204	0.234	0.299	1t9mA.pdb.gz	Structure of the phenazine biosynthesis enzyme PhzG.
16	PDB:1wv4A	0.548	0.868	7.753E-16	162	0.230	0.370	1wv4A.pdb.gz	Structure of Escherichia coli pyridoxine 5'-phosphate oxidase in a tetragonal crystal form: insights into the mechanistic pathway of the enzyme.
17	PDB:1xhnA	0.300	0.437	1.882E-7	172	0.111	0.169	1xhnA.pdb.gz
18	PDB:4qvbB	0.347	0.593	5.490E-6	144	0.080	0.146	4qvbB.pdb.gz	Molecular insights into the binding of coenzyme F420 to the conserved protein Rv1155 from Mycobacterium tuberculosis.
19	PDB:3f7eA	0.344	0.651	3.965E-5	128	0.084	0.172	3f7eA.pdb.gz
20	PDB:5jabA	0.322	0.598	3.218E-4	135	0.092	0.178	5jabA.pdb.gz	Rv2074 is a novel F420 H2 -dependent biliverdin reductase in Mycobacterium tuberculosis.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9NVS9	0.0	545	261	1.000	1.000	PNPO_HUMAN Pyridoxine-5'-phosphate oxidase OS=Homo sapiens OX=9606 GN=PNPO PE=1 SV=1
2	O88794	1.85e-177	490	261	0.897	0.897	PNPO_RAT Pyridoxine-5'-phosphate oxidase OS=Rattus norvegicus OX=10116 GN=Pnpo PE=1 SV=1
3	Q1PCB0	1.54e-78	239	257	0.452	0.459	PNPO_BOMMO Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Bombyx mori OX=7091 GN=PNPO PE=1 SV=1
4	Q9LTX3	1.94e-69	224	530	0.467	0.230	PPOX1_ARATH Pyridoxine/pyridoxamine 5'-phosphate oxidase 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=PPOX1 PE=1 SV=1
5	Q7KSW3	1.01e-66	209	237	0.402	0.443	Q7KSW3_DROME pyridoxal 5'-phosphate synthase OS=Drosophila melanogaster OX=7227 GN=sgll PE=1 SV=1
6	Q9VHZ5	1.24e-66	209	246	0.402	0.427	Q9VHZ5_DROME pyridoxal 5'-phosphate synthase OS=Drosophila melanogaster OX=7227 GN=sgll PE=1 SV=3
7	Q9UTQ1	3.74e-49	163	231	0.352	0.398	PDX3_SCHPO Probable pyridoxamine 5'-phosphate oxidase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC1093.02 PE=3 SV=1
8	P0AFI7	1.41e-44	151	218	0.299	0.358	PDXH_ECOLI Pyridoxine/pyridoxamine 5'-phosphate oxidase OS=Escherichia coli (strain K12) OX=83333 GN=pdxH PE=1 SV=2
9	P38075	2.79e-42	145	228	0.330	0.377	PDX3_YEAST Pyridoxamine 5'-phosphate oxidase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PDX3 PE=1 SV=1
10	P9WIJ1	1.27e-39	139	224	0.299	0.348	PDXH_MYCTU Pyridoxine 5'-phosphate oxidase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=pdxH PE=1 SV=1
11	Q820A5	1.72e-27	107	215	0.245	0.298	Q820A5_PSEAE Probable pyridoxamine 5'-phosphate oxidase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=phzG2 PE=3 SV=1
12	G3XCV4	2.09e-27	107	214	0.245	0.299	G3XCV4_PSEAE Probable pyridoxamine 5'-phosphate oxidase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=phzG1 PE=3 SV=1
13	O69755	2.09e-27	107	214	0.245	0.299	O69755_PSEAI Phenazine biosynthesis FMN-dependent oxidase PhzG OS=Pseudomonas aeruginosa OX=287 GN=phzG PE=1 SV=2
14	Q9ZPY1	1.98e-04	43.5	198	0.157	0.207	PPOX2_ARATH Pyridoxine/pyridoxamine 5'-phosphate oxidase 2 OS=Arabidopsis thaliana OX=3702 GN=PPOX2 PE=1 SV=2
15	H2L2C8	0.45	34.3	823	0.080	0.026	H2L2C8_CAEEL Alpha-actinin, sarcomeric OS=Caenorhabditis elegans OX=6239 GN=atn-1 PE=1 SV=1
16	H2L2C9	0.45	34.3	849	0.080	0.025	H2L2C9_CAEEL Alpha-actinin, sarcomeric OS=Caenorhabditis elegans OX=6239 GN=atn-1 PE=1 SV=1
17	Q9XVU8	0.45	34.3	894	0.080	0.023	Q9XVU8_CAEEL Alpha-actinin, sarcomeric OS=Caenorhabditis elegans OX=6239 GN=atn-1 PE=1 SV=1
18	Q23158	0.49	34.3	920	0.080	0.023	Q23158_CAEEL Alpha-actinin, sarcomeric OS=Caenorhabditis elegans OX=6239 GN=atn-1 PE=1 SV=1
19	M9NDS8	1.4	32.7	1245	0.077	0.016	M9NDS8_DROME Myosin binding subunit, isoform N OS=Drosophila melanogaster OX=7227 GN=Mbs PE=1 SV=1
20	M9NFF6	1.4	32.7	1243	0.077	0.016	M9NFF6_DROME Myosin binding subunit, isoform M OS=Drosophila melanogaster OX=7227 GN=Mbs PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10590 PNP_phzG_C	1.9e-14	64.6	Pyridoxine 5'-phosphate oxidase C-terminal dimerisation region
2	PF01243 Putative_PNPOx	3e-22	89.9	Pyridoxamine 5'-phosphate oxidase
3	PF12766 Pyridox_oxase_2	0.0021	30.0	Pyridoxamine 5'-phosphate oxidase

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000225573

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000291565	0.991	Pyridoxal kinase
2	9606.ENSP00000481046	0.959	Pyridoxal phosphate phosphatase PHOSPHO2
3	9606.ENSP00000215904	0.954	Pyridoxal phosphate phosphatase
4	9606.ENSP00000363832	0.923	Aldehyde oxidase
5	9606.ENSP00000403644	0.821	Aromatic-L-amino-acid decarboxylase
6	9606.ENSP00000311984	0.793	ATP-dependent (S)-NAD(P)H-hydrate dehydratase
7	9606.ENSP00000357218	0.767	NAD(P)H-hydrate epimerase
8	9606.ENSP00000365773	0.767	Phosphoserine aminotransferase
9	9606.ENSP00000333551	0.762	Pyridoxal phosphate homeostasis protein
10	9606.ENSP00000387123	0.743	Alpha-aminoadipic semialdehyde dehydrogenase
11	9606.ENSP00000454646	0.695	Putative sodium-coupled neutral amino acid transporter 7
12	9606.ENSP00000344816	0.691	BSD domain containing 1
13	9606.ENSP00000379838	0.690	Calcium-regulated heat-stable protein 1
14	9606.ENSP00000353025	0.668	Protein FAM3C
15	9606.ENSP00000369325	0.643	Cyclin-dependent kinase-like 5
16	9606.ENSP00000348108	0.642	KH domain-containing, RNA-binding, signal transduction-associated protein 3
17	9606.ENSP00000471454	0.632	Coiled-coil domain containing 61
18	9606.ENSP00000362399	0.631	Syntaxin-binding protein 1
19	9606.ENSP00000322020	0.611	Mitochondrial glutamate carrier 1
20	9606.ENSP00000365777	0.608	Methylenetetrahydrofolate reductase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	1.000	identical protein binding
GO:0004733	1.000	pyridoxamine-phosphate oxidase activity
GO:0046983	0.996	protein dimerization activity
GO:0042803	0.993	protein homodimerization activity
GO:0010181	0.991	FMN binding
GO:0019842	0.591	vitamin binding
GO:0030170	0.579	pyridoxal phosphate binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0018130	0.995	heterocycle biosynthetic process
GO:1901362	0.994	organic cyclic compound biosynthetic process
GO:1901566	0.994	organonitrogen compound biosynthetic process
GO:0044271	0.994	cellular nitrogen compound biosynthetic process
GO:0044281	0.990	small molecule metabolic process
GO:0072524	0.988	pyridine-containing compound metabolic process
GO:0042816	0.980	vitamin B6 metabolic process
GO:0009110	0.976	vitamin biosynthetic process
GO:0006081	0.975	cellular aldehyde metabolic process
GO:1901615	0.972	organic hydroxy compound metabolic process
GO:0019637	0.969	organophosphate metabolic process
GO:0072525	0.964	pyridine-containing compound biosynthetic process
GO:0042364	0.960	water-soluble vitamin biosynthetic process
GO:0090407	0.957	organophosphate biosynthetic process
GO:0019438	0.935	aromatic compound biosynthetic process
GO:0006796	0.917	phosphate-containing compound metabolic process
GO:1901617	0.915	organic hydroxy compound biosynthetic process
GO:0046184	0.512	aldehyde biosynthetic process
GO:0065007	0.368	biological regulation
GO:0050789	0.353	regulation of biological process
GO:0050794	0.311	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.998	cytosol
GO:0043227	0.950	membrane-bounded organelle
GO:0043229	0.950	intracellular organelle
GO:0043231	0.941	intracellular membrane-bounded organelle
GO:0070013	0.728	intracellular organelle lumen
GO:0005739	0.487	mitochondrion

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:15817	1.000	H2O + O2 + pyridoxamine 5'-phosphate = H2O2 + NH4(+) + pyridoxal 5'-phosphate
EC:1.4.3.5	1.000	pyridoxal 5'-phosphate synthase.

[back to server]