StarFunc result for job id Q9NVV9

User Input

>input (213 residues)
MVQSCSAYGCKNRYDKDKPVSFHKFPLTRPSLCKEWEAAVRRKNFKPTKYSSICSEHFTP
DCFKRECNNKLLKENAVPTIFLCTEPHDKKEDLLEPQEQLPPPPLPPPVSQVDAAIGLLM
PPLQTPVNLSVFCDHNYTVEDTMHQRKRIHQLEQQVEKLRKKLKTAQQRCRRQERQLEKL
KEVVHFQKEKDDVSERGYVILPNDYFEIVEVPA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NVV9	0.999	0.999	1.828E-35	213	1.000	1.000	Q9NVV9.pdb.gz	THAP1_HUMAN THAP domain-containing protein 1 OS=Homo sapiens OX=9606 GN=THAP1 PE=1 SV=1
2	AFDB:Q8WTV1	0.374	0.334	8.132E-11	239	0.315	0.280	Q8WTV1.pdb.gz	THAP3_HUMAN THAP domain-containing protein 3 OS=Homo sapiens OX=9606 GN=THAP3 PE=1 SV=1
3	AFDB:Q9H0W7	0.380	0.356	9.225E-10	228	0.315	0.294	Q9H0W7.pdb.gz	THAP2_HUMAN THAP domain-containing protein 2 OS=Homo sapiens OX=9606 GN=THAP2 PE=1 SV=1
4	AFDB:Q8NA92	0.358	0.281	3.764E-9	274	0.244	0.190	Q8NA92.pdb.gz	THAP8_HUMAN THAP domain-containing protein 8 OS=Homo sapiens OX=9606 GN=THAP8 PE=1 SV=1
5	AFDB:Q8WY91	0.370	0.141	2.253E-8	577	0.216	0.080	Q8WY91.pdb.gz	THAP4_HUMAN Peroxynitrite isomerase THAP4 OS=Homo sapiens OX=9606 GN=THAP4 PE=1 SV=2
6	AFDB:Q7Z6K1	0.353	0.195	3.757E-8	395	0.211	0.114	Q7Z6K1.pdb.gz	THAP5_HUMAN THAP domain-containing protein 5 OS=Homo sapiens OX=9606 GN=THAP5 PE=1 SV=2
7	AFDB:Q8TBB0	0.380	0.367	9.783E-7	222	0.225	0.216	Q8TBB0.pdb.gz	THAP6_HUMAN THAP domain-containing protein 6 OS=Homo sapiens OX=9606 GN=THAP6 PE=1 SV=1
8	AFDB:Q9H5L6	0.373	0.093	1.347E-6	903	0.197	0.047	Q9H5L6.pdb.gz	THAP9_HUMAN DNA transposase THAP9 OS=Homo sapiens OX=9606 GN=THAP9 PE=1 SV=2
9	AFDB:Q9VJ27	0.360	0.108	1.041E-5	762	0.164	0.046	Q9VJ27.pdb.gz	Q9VJ27_DROME Uncharacterized protein, isoform A OS=Drosophila melanogaster OX=7227 GN=Dmel\CG10431 PE=4 SV=3
10	AFDB:Q9NHV6	0.316	0.299	1.259E-4	226	0.150	0.142	Q9NHV6.pdb.gz	Q9NHV6_DROME Dorsal interacting protein 2 OS=Drosophila melanogaster OX=7227 GN=Dlip2 PE=2 SV=1
11	PDB:7kzmE	0.089	0.049	7.338	474	0.070	0.032	7kzmE.pdb.gz	Structure of a microtubule-bound axonemal dynein.
12	PDB:2avuE	0.060	0.077	8.338	156	0.019	0.026	2avuE.pdb.gz	Structure of the Escherichia coli FlhDC Complex, a Prokaryotic Heteromeric Regulator of Transcription.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9NVV9	2.84e-158	437	213	1.000	1.000	THAP1_HUMAN THAP domain-containing protein 1 OS=Homo sapiens OX=9606 GN=THAP1 PE=1 SV=1
2	Q9H0W7	1.19e-26	103	228	0.315	0.294	THAP2_HUMAN THAP domain-containing protein 2 OS=Homo sapiens OX=9606 GN=THAP2 PE=1 SV=1
3	Q8WTV1	3.79e-23	95.1	239	0.211	0.188	THAP3_HUMAN THAP domain-containing protein 3 OS=Homo sapiens OX=9606 GN=THAP3 PE=1 SV=1
4	Q8WY91	2.02e-17	82.0	577	0.207	0.076	THAP4_HUMAN Peroxynitrite isomerase THAP4 OS=Homo sapiens OX=9606 GN=THAP4 PE=1 SV=2
5	Q7Z6K1	7.17e-13	68.6	395	0.169	0.091	THAP5_HUMAN THAP domain-containing protein 5 OS=Homo sapiens OX=9606 GN=THAP5 PE=1 SV=2
6	Q8NA92	9.49e-12	64.7	274	0.174	0.135	THAP8_HUMAN THAP domain-containing protein 8 OS=Homo sapiens OX=9606 GN=THAP8 PE=1 SV=1
7	Q9VJ27	2.09e-11	64.7	762	0.146	0.041	Q9VJ27_DROME Uncharacterized protein, isoform A OS=Drosophila melanogaster OX=7227 GN=Dmel\CG10431 PE=4 SV=3
8	Q8TBB0	5.34e-07	50.8	222	0.249	0.239	THAP6_HUMAN THAP domain-containing protein 6 OS=Homo sapiens OX=9606 GN=THAP6 PE=1 SV=1
9	Q9H5L6	1.10e-05	47.8	903	0.225	0.053	THAP9_HUMAN DNA transposase THAP9 OS=Homo sapiens OX=9606 GN=THAP9 PE=1 SV=2
10	Q9BT49	1.06e-04	44.3	309	0.150	0.104	THAP7_HUMAN THAP domain-containing protein 7 OS=Homo sapiens OX=9606 GN=THAP7 PE=1 SV=2
11	Q9CUX1	0.032	37.4	758	0.127	0.036	P52K_MOUSE 52 kDa repressor of the inhibitor of the protein kinase OS=Mus musculus OX=10090 GN=Thap12 PE=2 SV=2
12	O43422	0.034	37.4	761	0.127	0.035	P52K_HUMAN 52 kDa repressor of the inhibitor of the protein kinase OS=Homo sapiens OX=9606 GN=THAP12 PE=1 SV=2
13	P91193	0.044	37.0	897	0.089	0.021	MACO1_CAEEL Macoilin OS=Caenorhabditis elegans OX=6239 GN=maco-1 PE=2 SV=4
14	Q9JJD0	0.26	34.3	305	0.094	0.066	THA11_MOUSE THAP domain-containing protein 11 OS=Mus musculus OX=10090 GN=Thap11 PE=1 SV=1
15	Q96EK4	0.28	34.3	314	0.094	0.064	THA11_HUMAN THAP domain-containing protein 11 OS=Homo sapiens OX=9606 GN=THAP11 PE=1 SV=2
16	Q8GY23	0.58	33.5	3681	0.094	0.005	UPL1_ARATH E3 ubiquitin-protein ligase UPL1 OS=Arabidopsis thaliana OX=3702 GN=UPL1 PE=1 SV=3
17	Q57YG9	2.3	31.6	881	0.085	0.020	Q57YG9_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb08.12O16.170 PE=4 SV=1
18	Q9C9X0	2.3	31.6	622	0.136	0.047	MP701_ARATH Microtubule-associated protein 70-1 OS=Arabidopsis thaliana OX=3702 GN=MAP70.1 PE=1 SV=1
19	M9MRU0	2.6	31.6	2567	0.070	0.006	M9MRU0_DROME Wing blister, isoform C OS=Drosophila melanogaster OX=7227 GN=wb PE=4 SV=1
20	Q8TE73	2.7	31.6	4624	0.089	0.004	DYH5_HUMAN Dynein axonemal heavy chain 5 OS=Homo sapiens OX=9606 GN=DNAH5 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12848 ABC_tran_Xtn	5.1e+02	12.1	ABC transporter
2	PF11559 ADIP	22	16.6	Afadin- and alpha -actinin-Binding
3	PF08614 ATG16	2.3	19.9	Autophagy protein 16 (ATG16)
4	PF14073 Cep57_CLD	0.058	24.9	Centrosome localisation domain of Cep57
5	PF04977 DivIC	7.9e+02	11.2	Septum formation initiator
6	PF01519 DUF16	75	15.2	Protein of unknown function DUF16
7	PF14335 DUF4391	61	14.8	Domain of unknown function (DUF4391)
8	PF14362 DUF4407	9.6e+02	10.4	Domain of unknown function (DUF4407)
9	PF04504 DUF573	2.4e+02	13.8	Protein of unknown function, DUF573
10	PF19111 DUF5798	2.3e+02	13.4	Family of unknown function (DUF5798)
11	PF02601 Exonuc_VII_L	1.6e+02	13.3	Exonuclease VII, large subunit
12	PF06818 Fez1	1.1	21.1	Fez1
13	PF05377 FlaC_arch	1.7e+02	14.0	Flagella accessory protein C (FlaC)
14	PF07195 FliD_C	2.1e+02	12.7	Flagellar hook-associated protein 2 C-terminus
15	PF01025 GrpE	1.1e+02	13.8	GrpE
16	PF09726 Macoilin	3.7e+02	11.0	Macoilin family
17	PF17060 MPS2	63	14.5	Monopolar spindle protein 2
18	PF16454 PI3K_P85_iSH2	1.5e+02	13.3	Phosphatidylinositol 3-kinase regulatory subunit P85 inter-SH2 domain
19	PF06428 Sec2p	1.3	20.4	GDP/GTP exchange factor Sec2p
20	PF05485 THAP	4.1e-15	67.7	THAP domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000011067

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000003094	0.782	Host cell factor C1
2	60711.ENSCSAP00000010780	0.714	Torsin family 1, member A (torsin A)
3	60711.ENSCSAP00000018012	0.699	THAP domain containing 11
4	60711.ENSCSAP00000000324	0.696	PRKC, apoptosis, WT1, regulator
5	60711.ENSCSAP00000013333	0.674	BTB (POZ) domain containing 1
6	60711.ENSCSAP00000004871	0.666	Calcium binding protein 4
7	60711.ENSCSAP00000009051	0.665	THAP domain containing 7
8	60711.ENSCSAP00000000724	0.656	NLR family, pyrin domain containing 14
9	60711.ENSCSAP00000011062	0.656	Ring finger protein 170
10	60711.ENSCSAP00000009909	0.646	Cilia and flagella associated protein 157
11	60711.ENSCSAP00000019203	0.646	Protein phosphatase 1, regulatory subunit 26
12	60711.ENSCSAP00000004888	0.645	Transmembrane protein 134
13	60711.ENSCSAP00000008980	0.642	Sarcoglycan, epsilon
14	60711.ENSCSAP00000004858	0.622	Ribosomal protein S6 kinase, 70kDa, polypeptide 2
15	60711.ENSCSAP00000013557	0.622	Guanine nucleotide binding protein (G protein), alpha activating activity polypeptide, olfactory type
16	60711.ENSCSAP00000004922	0.574	Phosphatidylinositol transfer protein, membrane-associated 1
17	60711.ENSCSAP00000010195	0.571	CDKN1A interacting zinc finger protein 1
18	60711.ENSCSAP00000000252	0.569	THAP domain containing 12
19	60711.ENSCSAP00000015029	0.566	Host cell factor C2
20	60711.ENSCSAP00000001512	0.564	Anoctamin 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0001227	0.999	DNA-binding transcription repressor activity, RNA polymerase II-specific
GO:0000978	0.999	RNA polymerase II cis-regulatory region sequence-specific DNA binding
GO:0042803	0.998	protein homodimerization activity
GO:0008270	0.998	zinc ion binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.997	regulation of cellular process
GO:0006355	0.990	regulation of DNA-templated transcription
GO:0071704	0.988	organic substance metabolic process
GO:0044238	0.986	primary metabolic process
GO:0044237	0.986	cellular metabolic process
GO:0051172	0.985	negative regulation of nitrogen compound metabolic process
GO:0010605	0.985	negative regulation of macromolecule metabolic process
GO:0031324	0.985	negative regulation of cellular metabolic process
GO:0006807	0.982	nitrogen compound metabolic process
GO:0043170	0.975	macromolecule metabolic process
GO:0009890	0.968	negative regulation of biosynthetic process
GO:0009058	0.966	biosynthetic process
GO:0001935	0.963	endothelial cell proliferation
GO:0046483	0.956	heterocycle metabolic process
GO:0034641	0.955	cellular nitrogen compound metabolic process
GO:0090304	0.949	nucleic acid metabolic process
GO:0006357	0.949	regulation of transcription by RNA polymerase II
GO:0045892	0.948	negative regulation of DNA-templated transcription
GO:0010467	0.933	gene expression
GO:0034654	0.932	nucleobase-containing compound biosynthetic process
GO:0006351	0.913	DNA-templated transcription
GO:0000122	0.667	negative regulation of transcription by RNA polymerase II
GO:0051726	0.564	regulation of cell cycle
GO:0007346	0.492	regulation of mitotic cell cycle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0005730	0.997	nucleolus
GO:0001650	0.991	fibrillar center
GO:0016020	0.808	membrane
GO:0005737	0.762	cytoplasm
GO:0012505	0.436	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]