StarFunc result for job id Q9NW08

User Input

>input (1133 residues)
MDVLAEEFGNLTPEQLAAPIPTVEEKWRLLPAFLKVKGLVKQHIDSFNYFINVEIKKIMK
ANEKVTSDADPMWYLKYLNIYVGLPDVEESFNVTRPVSPHECRLRDMTYSAPITVDIEYT
RGSQRIIRNALPIGRMPIMLRSSNCVLTGKTPAEFAKLNECPLDPGGYFIVKGVEKVILI
QEQLSKNRIIVEADRKGAVGASVTSSTHEKKSRTNMAVKQGRFYLRHNTLSEDIPIVIIF
KAMGVESDQEIVQMIGTEEHVMAAFGPSLEECQKAQIFTQMQALKYIGNKVRRQRMWGGG
PKKTKIEEARELLASTILTHVPVKEFNFRAKCIYTAVMVRRVILAQGDNKVDDRDYYGNK
RLELAGQLLSLLFEDLFKKFNSEMKKIADQVIPKQRAAQFDVVKHMRQDQITNGMVNAIS
TGNWSLKRFKMDRQGVTQVLSRLSYISALGMMTRISSQFEKTRKVSGPRSLQPSQWGMLC
PSDTPEGEACGLVKNLALMTHITTDMEDGPIVKLASNLGVEDVNLLCGEELSYPNVFLVF
LNGNILGVIRDHKKLVNTFRLMRRAGYINEFVSISTNLTDRCVYISSDGGRLCRPYIIVK
KQKPAVTNKHMEELAQGYRNFEDFLHESLVEYLDVNEENDCNIALYEHTINKDTTHLEIE
PFTLLGVCAGLIPYPHHNQSPRNTYQCAMGKQAMGTIGYNQRNRIDTLMYLLAYPQKPMV
KTKTIELIEFEKLPAGQNATVAVMSYSGYDIEDALVLNKASLDRGFGRCLVYKNAKCTLK
RYTNQTFDKVMGPMLDAATRKPIWRHEILDADGICSPGEKVENKQVLVNKSMPTVTQIPL
EGSNVPQQPQYKDVPITYKGATDSYIEKVMISSNAEDAFLIKMLLRQTRRPEIGDKFSSR
HGQKGVCGLIVPQEDMPFCDSGICPDIIMNPHGFPSRMTVGKLIELLAGKAGVLDGRFHY
GTAFGGSKVKDVCEDLVRHGYNYLGKDYVTSGITGEPLEAYIYFGPVYYQKLKHMVLDKM
HARARGPRAVLTRQPTEGRSRDGGLRLGEMERDCLIGYGASMLLLERLMISSDAFEVDVC
GQCGLLGYSGWCHYCKSSCHVSSLRIPYACKLLFQELQSMNIIPRLKLSKYNE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Length	ID1	ID2	Download	Description
1	PDB:3k7aB	0.881	0.889	1122	0.379	0.382	3k7aB.pdb.gz	Structure of an RNA polymerase II-TFIIB complex and the transcription initiation mechanism.
2	PDB:4aybB	0.909	0.933	1103	0.364	0.374	4aybB.pdb.gz	Structural and Functional Analyses of the Interaction of Archaeal RNA Polymerase with DNA.
3	PDB:4bxxB	0.876	0.905	1097	0.377	0.389	4bxxB.pdb.gz	Structures of RNA Polymerase II Complexes with Bye1, a Chromatin-Binding Phf3/Dido1 Homologue
4	PDB:5iy6B	0.897	0.874	1165	0.389	0.379	5iy6B.pdb.gz	Near-atomic resolution visualization of human transcription promoter opening.
5	PDB:6cnbB	0.934	0.950	1114	0.613	0.623	6cnbB.pdb.gz	Structural visualization of RNA polymerase III transcription machineries.
6	PDB:6o6cB	0.905	0.881	1165	0.382	0.372	6o6cB.pdb.gz	3.1 angstrom structure of yeast RNA polymerase II elongation complex stalled at a cyclobutane pyrimidine dimer lesion solved using streptavidin affinity grids.
7	PDB:7astM	0.939	0.955	1114	0.967	0.984	7astM.pdb.gz
8	PDB:7d58B	0.947	0.979	1095	0.958	0.991	7d58B.pdb.gz	Structural insights into transcriptional regulation of human RNA polymerase III.
9	PDB:7dn3B	0.903	0.979	1044	0.919	0.997	7dn3B.pdb.gz	Structure of human RNA polymerase III elongation complex.
10	PDB:7o4iB	0.903	0.868	1180	0.384	0.369	7o4iB.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.
11	AFDB:A5PJW8	0.925	0.893	1174	0.390	0.376	A5PJW8.pdb.gz	A5PJW8_BOVIN DNA-directed RNA polymerase subunit beta OS=Bos taurus OX=9913 GN=POLR2B PE=1 SV=1
12	AFDB:B8YB55	0.920	0.921	1131	0.364	0.364	B8YB55.pdb.gz	RPO2_SACSH DNA-directed RNA polymerase subunit Rpo2 OS=Saccharolobus shibatae OX=2286 GN=rpo2 PE=1 SV=1
13	AFDB:F4KD38	0.961	0.938	1161	0.567	0.553	F4KD38.pdb.gz	NRPC2_ARATH DNA-directed RNA polymerase III subunit 2 OS=Arabidopsis thaliana OX=3702 GN=NRPC2 PE=2 SV=1
14	AFDB:P08266	0.928	0.894	1176	0.388	0.374	P08266.pdb.gz	RPB2_DROME DNA-directed RNA polymerase II subunit RPB2 OS=Drosophila melanogaster OX=7227 GN=RpII140 PE=2 SV=2
15	AFDB:P08518	0.914	0.848	1224	0.390	0.361	P08518.pdb.gz	RPB2_YEAST DNA-directed RNA polymerase II subunit RPB2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RPB2 PE=1 SV=2
16	AFDB:P11513	0.913	0.918	1126	0.356	0.358	P11513.pdb.gz	RPO2_SULAC DNA-directed RNA polymerase subunit Rpo2 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) OX=330779 GN=rpo2 PE=1 SV=2
17	AFDB:P22276	0.964	0.951	1149	0.626	0.617	P22276.pdb.gz	RPC2_YEAST DNA-directed RNA polymerase III subunit RPC2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RET1 PE=1 SV=2
18	AFDB:P38420	0.924	0.882	1188	0.387	0.370	P38420.pdb.gz	NRPB2_ARATH DNA-directed RNA polymerase II subunit 2 OS=Arabidopsis thaliana OX=3702 GN=NRPB2 PE=1 SV=2
19	AFDB:Q02061	0.909	0.853	1210	0.372	0.348	Q02061.pdb.gz	RPB2_SCHPO DNA-directed RNA polymerase II subunit RPB2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rpb2 PE=1 SV=2
20	AFDB:Q10233	0.978	0.952	1165	0.637	0.620	Q10233.pdb.gz	RPC2_SCHPO DNA-directed RNA polymerase III subunit RPC2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rpc2 PE=2 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A5PJW8	0.0	794	1174	0.398	0.384	A5PJW8_BOVIN DNA-directed RNA polymerase subunit beta OS=Bos taurus OX=9913 GN=POLR2B PE=1 SV=1
2	B8YB55	0.0	740	1131	0.371	0.371	RPO2_SACSH DNA-directed RNA polymerase subunit Rpo2 OS=Saccharolobus shibatae OX=2286 GN=rpo2 PE=1 SV=1
3	C9J2Y9	0.0	792	1167	0.396	0.385	C9J2Y9_HUMAN DNA-directed RNA polymerase subunit beta OS=Homo sapiens OX=9606 GN=POLR2B PE=1 SV=2
4	C9J4M6	0.0	758	1067	0.377	0.400	C9J4M6_HUMAN DNA-directed RNA polymerase subunit beta OS=Homo sapiens OX=9606 GN=POLR2B PE=1 SV=3
5	F1QQA2	0.0	2247	1130	0.941	0.943	F1QQA2_DANRE DNA-directed RNA polymerase subunit beta OS=Danio rerio OX=7955 GN=polr3b PE=1 SV=2
6	F4KD38	0.0	1303	1161	0.570	0.556	NRPC2_ARATH DNA-directed RNA polymerase III subunit 2 OS=Arabidopsis thaliana OX=3702 GN=NRPC2 PE=2 SV=1
7	P08266	0.0	778	1176	0.388	0.374	RPB2_DROME DNA-directed RNA polymerase II subunit RPB2 OS=Drosophila melanogaster OX=7227 GN=RpII140 PE=2 SV=2
8	P08518	0.0	764	1224	0.409	0.378	RPB2_YEAST DNA-directed RNA polymerase II subunit RPB2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RPB2 PE=1 SV=2
9	P11513	0.0	714	1126	0.370	0.372	RPO2_SULAC DNA-directed RNA polymerase subunit Rpo2 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) OX=330779 GN=rpo2 PE=1 SV=2
10	P22276	0.0	1433	1149	0.624	0.615	RPC2_YEAST DNA-directed RNA polymerase III subunit RPC2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=RET1 PE=1 SV=2
11	P30876	0.0	793	1174	0.396	0.382	RPB2_HUMAN DNA-directed RNA polymerase II subunit RPB2 OS=Homo sapiens OX=9606 GN=POLR2B PE=1 SV=1
12	P38420	0.0	774	1188	0.398	0.380	NRPB2_ARATH DNA-directed RNA polymerase II subunit 2 OS=Arabidopsis thaliana OX=3702 GN=NRPB2 PE=1 SV=2
13	Q02061	0.0	739	1210	0.383	0.359	RPB2_SCHPO DNA-directed RNA polymerase II subunit RPB2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rpb2 PE=1 SV=2
14	Q10233	0.0	1494	1165	0.643	0.626	RPC2_SCHPO DNA-directed RNA polymerase III subunit RPC2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rpc2 PE=2 SV=1
15	Q4GZE8	0.0	1119	1129	0.500	0.502	Q4GZE8_TRYB2 DNA-directed RNA polymerase subunit beta OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.540 PE=3 SV=1
16	Q583H5	0.0	687	1190	0.374	0.356	Q583H5_TRYB2 DNA-directed RNA polymerase subunit beta OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.30O21.140 PE=3 SV=1
17	Q8CFI7	0.0	793	1174	0.396	0.382	RPB2_MOUSE DNA-directed RNA polymerase II subunit RPB2 OS=Mus musculus OX=10090 GN=Polr2b PE=1 SV=2
18	Q980R1	0.0	748	1124	0.377	0.380	RPO2_SACS2 DNA-directed RNA polymerase subunit Rpo2 OS=Saccharolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) OX=273057 GN=rpo2 PE=1 SV=2
19	Q9NW08	0.0	2364	1133	1.000	1.000	RPC2_HUMAN DNA-directed RNA polymerase III subunit RPC2 OS=Homo sapiens OX=9606 GN=POLR3B PE=1 SV=2
20	Q9LK40	9.00e-142	459	1172	0.312	0.302	NRPD2_ARATH DNA-directed RNA polymerases IV and V subunit 2 OS=Arabidopsis thaliana OX=3702 GN=NRPD2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04563 RNA_pol_Rpb2_1	1.1e-50	183.6	RNA polymerase beta subunit
2	PF04561 RNA_pol_Rpb2_2	3.9e-24	96.9	RNA polymerase Rpb2, domain 2
3	PF04565 RNA_pol_Rpb2_3	5.8e-17	72.9	RNA polymerase Rpb2, domain 3
4	PF04566 RNA_pol_Rpb2_4	2.3e-23	93.5	RNA polymerase Rpb2, domain 4
5	PF04567 RNA_pol_Rpb2_5	0.00028	32.9	RNA polymerase Rpb2, domain 5
6	PF00562 RNA_pol_Rpb2_6	6.2e-124	425.6	RNA polymerase Rpb2, domain 6
7	PF04560 RNA_pol_Rpb2_7	1.8e-31	119.7	RNA polymerase Rpb2, domain 7

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 29073.XP_008703880.1

Rank	PPI partner	STRING score	Description
1	29073.XP_008686317.1	0.999	DNA-directed RNA polymerase II subunit RPB1
2	29073.XP_008694313.1	0.999	DNA-directed RNA polymerase III subunit RPC1
3	29073.XP_008705968.1	0.998	DNA-directed RNA polymerase III subunit RPC3 isoform X1
4	29073.XP_008690096.1	0.997	RNA polymerase I subunit C
5	29073.XP_008695401.1	0.997	DNA-directed RNA polymerase III subunit RPC5 isoform X1
6	29073.XP_008700309.1	0.997	DNA-directed RNA polymerase III subunit RPC4 isoform X1
7	29073.XP_008701168.1	0.997	DNA-directed RNA polymerase III subunit RPC8 isoform X1
8	29073.XP_008708252.1	0.997	DNA-directed RNA polymerase III subunit RPC6 isoform X1
9	29073.XP_008694902.1	0.996	DNA-directed RNA polymerase III subunit RPC10
10	29073.XP_008709581.1	0.996	DNA-directed RNA polymerases I, II, and III subunit RPABC1
11	29073.XP_008690506.1	0.995	DNA-directed RNA polymerases I and III subunit RPAC2
12	29073.XP_008696803.1	0.995	CGRP receptor component
13	29073.XP_008703462.1	0.995	DNA-directed RNA polymerases I, II, and III subunit RPABC3
14	29073.XP_008703786.1	0.987	DNA-directed RNA polymerases I, II, and III subunit RPABC2
15	29073.XP_008697897.1	0.986	DNA-directed RNA polymerases I, II, and III subunit RPABC5
16	29073.XP_008698344.1	0.985	DNA-directed RNA polymerase I subunit RPA2
17	29073.XP_008698307.1	0.982	DNA-dependent RNA polymerase catalyzes the transcription of DNA into RNA using the four ribonucleoside triphosphates as substrates.
18	29073.XP_008687427.1	0.981	DNA-directed RNA polymerases I, II, and III subunit RPABC4
19	29073.XP_008699054.1	0.971	DNA-directed RNA polymerase III subunit RPC7
20	29073.XP_008704304.1	0.940	BRF1, RNA polymerase III transcription initiation factor subunit

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003899	0.996	DNA-directed 5'-3' RNA polymerase activity
GO:0003676	0.958	nucleic acid binding
GO:0003723	0.952	RNA binding
GO:0003677	0.705	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0071704	0.990	organic substance metabolic process
GO:0044238	0.989	primary metabolic process
GO:0044237	0.989	cellular metabolic process
GO:0034654	0.957	nucleobase-containing compound biosynthetic process
GO:0009059	0.946	macromolecule biosynthetic process
GO:0006351	0.943	DNA-templated transcription
GO:0050789	0.941	regulation of biological process
GO:0032501	0.694	multicellular organismal process
GO:0032502	0.686	developmental process
GO:0048856	0.677	anatomical structure development
GO:0007275	0.657	multicellular organism development
GO:0048731	0.648	system development
GO:0019222	0.628	regulation of metabolic process
GO:0048518	0.626	positive regulation of biological process
GO:0060255	0.602	regulation of macromolecule metabolic process
GO:0048583	0.476	regulation of response to stimulus
GO:0035272	0.436	exocrine system development
GO:0050794	0.422	regulation of cellular process
GO:0010468	0.409	regulation of gene expression
GO:0002831	0.309	regulation of response to biotic stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:1902494	0.999	catalytic complex
GO:0140513	0.994	nuclear protein-containing complex
GO:0005829	0.991	cytosol
GO:1990234	0.987	transferase complex
GO:0140535	0.983	intracellular protein-containing complex
GO:0055029	0.967	nuclear DNA-directed RNA polymerase complex
GO:0043232	0.926	intracellular non-membrane-bounded organelle
GO:0005730	0.596	nucleolus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.7.7.6	0.996	DNA-directed RNA polymerase.

[back to server]