StarFunc result for job id Q9NW13

User Input

>input (759 residues)
MAGLTLFVGRLPPSARSEQLEELFSQVGPVKQCFVVTEKGSKACRGFGYVTFSMLEDVQR
ALKEITTFEGCKINVTVAKKKLRNKTKEKGKNENSECPKKEPKAKKAKVADKKARLIIRN
LSFKCSEDDLKTVFAQFGAVLEVNIPRKPDGKMRGFGFVQFKNLLEAGKALKGMNMKEIK
GRTVAVDWAVAKDKYKDTQSVSAIGEEKSHESKHQESVKKKGREEEDMEEEENDDDDDDD
DEEDGVFDDEDEEEENIESKVTKPVQIQKRAVKRPAPAKSSDHSEEDSDLEESDSIDDGE
ELAQSDTSTEEQEDKAVQVSNKKKRKLPSDVNEGKTVFIRNLSFDSEEEELGELLQQFGE
LKYVRIVLHPDTEHSKGCAFAQFMTQEAAQKCLLAASPENEAGGLKLDGRQLKVDLAVTR
DEAAKLQTTKVKKPTGTRNLYLAREGLIRAGTKAAEGVSAADMAKRERFELLKHQKLKDQ
NIFVSRTRLCLHNLPKAVDDKQLRKLLLSATSGEKGVRIKECRVMRDLKGVHGNMKGQSL
GYAFAEFQEHEHALKALRLINNNPEIFGPLKRPIVEFSLEDRRKLKMKELRIQRSLQKMR
SKPATGEPQKGQPEPAKDQQQKAAQHHTEEQSKVPPEQKRKAGSTSWTGFQTKAEVEQVE
LPDGKKRRKVLALPSHRGPKIRLRDKGKVKPVHPKKPKPQINQWKQEKQQLSSEQVSRKK
AKGNKTETRFNQLVEQYKQKLLGPSKGAPLAKRSKWFDS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A024R753	0.256	0.256	0.000	759	1.000	1.000	A0A024R753.pdb.gz	A0A024R753_HUMAN RNA binding motif protein 28 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=RBM28 PE=2 SV=1
2	AFDB:A0A024R9C1	0.150	0.174	1.190E-30	636	0.157	0.187	A0A024R9C1.pdb.gz
3	AFDB:E9AFX7	0.134	0.172	1.889E-26	560	0.140	0.189	E9AFX7.pdb.gz	E9AFX7_LEIMA Polyadenylate-binding protein OS=Leishmania major OX=5664 GN=PABP1 PE=1 SV=1
4	AFDB:Q20084	0.118	0.185	1.147E-22	456	0.108	0.180	Q20084.pdb.gz	Q20084_CAEEL RRM domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=exc-7 PE=1 SV=1
5	AFDB:Q9VHC7	0.111	0.129	1.460E-19	632	0.104	0.125	Q9VHC7.pdb.gz	Q9VHC7_DROME FI21236p1 OS=Drosophila melanogaster OX=7227 GN=rump PE=1 SV=1
6	AFDB:A0A024R7T3	0.112	0.191	1.856E-19	415	0.096	0.176	A0A024R7T3.pdb.gz
7	AFDB:Q80XZ1	0.121	0.152	1.856E-19	588	0.119	0.153	Q80XZ1.pdb.gz	Q80XZ1_RAT Polypyrimidine tract-binding protein OS=Rattus norvegicus OX=10116 GN=Smptb PE=1 SV=1
8	AFDB:A0A2R8QPL1	0.132	0.229	1.520E-18	386	0.109	0.215	A0A2R8QPL1.pdb.gz
9	AFDB:Q57UT5	0.115	0.216	1.520E-18	384	0.094	0.185	Q57UT5.pdb.gz	Q57UT5_TRYB2 RNA-binding protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.5D20.490 PE=4 SV=1
10	PDB:5vsuA	0.150	0.230	3.735E-18	387	0.099	0.194	5vsuA.pdb.gz	Architecture of the U6 snRNP reveals specific recognition of 3'-end processed U6 snRNA.
11	AFDB:Q9UT83	0.111	0.136	1.784E-17	609	0.136	0.169	Q9UT83.pdb.gz	MUG28_SCHPO Meiotically up-regulated gene 28 protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mug28 PE=1 SV=1
12	PDB:6r5kH	0.118	0.202	4.390E-14	394	0.129	0.249	6r5kH.pdb.gz	Molecular Basis for poly(A) RNP Architecture and Recognition by the Pan2-Pan3 Deadenylase.
13	PDB:7oqcF	0.121	0.281	1.374E-13	267	0.069	0.195	7oqcF.pdb.gz	Structural insights into how Prp5 proofreads the pre-mRNA branch site.
14	PDB:6y53o	0.099	0.451	1.403E-11	160	0.066	0.312	6y53o.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
15	PDB:5lsbA	0.099	0.391	3.191E-10	176	0.065	0.278	5lsbA.pdb.gz
16	PDB:7evoD	0.107	0.395	6.967E-10	200	0.054	0.205	7evoD.pdb.gz	Structural Insights into Branch Site Proofreading by Human Spliceosome.
17	PDB:6y5qq	0.101	0.395	2.774E-9	178	0.051	0.219	6y5qq.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
18	PDB:6ff7X	0.098	0.398	1.150E-7	171	0.051	0.228	6ff7X.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
19	PDB:6qx91K	0.109	0.394	1.860E-7	201	0.034	0.129	6qx91K.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
20	PDB:5yzg1	0.102	0.314	3.602E-7	243	0.033	0.103	5yzg1.pdb.gz	Structure of a human catalytic step I spliceosome

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A024R753	0.0	1546	759	1.000	1.000	A0A024R753_HUMAN RNA binding motif protein 28 isoform 1 (Fragment) OS=Homo sapiens OX=9606 GN=RBM28 PE=2 SV=1
2	Q9NW13	0.0	1546	759	1.000	1.000	RBM28_HUMAN RNA-binding protein 28 OS=Homo sapiens OX=9606 GN=RBM28 PE=1 SV=3
3	O74400	3.70e-54	200	674	0.253	0.285	YOCE_SCHPO Uncharacterized RNA-binding protein C4F6.14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC4F6.14 PE=1 SV=1
4	P37838	1.01e-26	118	685	0.099	0.109	NOP4_YEAST Nucleolar protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NOP4 PE=1 SV=1
5	Q381I4	5.67e-23	104	433	0.144	0.252	Q381I4_TRYB2 RNA-binding protein, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.7680 PE=4 SV=1
6	Q5AB84	5.32e-21	98.2	400	0.083	0.158	Q5AB84_CANAL RRM domain-containing protein OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=CAALFM_C100160CA PE=4 SV=1
7	P27476	1.36e-18	91.3	414	0.078	0.143	NSR1_YEAST Nuclear localization sequence-binding protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=NSR1 PE=1 SV=1
8	Q9FGS0	2.77e-18	88.2	289	0.072	0.190	CP31B_ARATH RNA-binding protein CP31B, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CP31B PE=1 SV=1
9	Q8R3C6	4.17e-18	91.7	952	0.099	0.079	RBM19_MOUSE Probable RNA-binding protein 19 OS=Mus musculus OX=10090 GN=Rbm19 PE=1 SV=1
10	O82299	3.98e-17	85.1	308	0.087	0.214	O82299_ARATH Putative chloroplast RNA binding protein OS=Arabidopsis thaliana OX=3702 GN=At2g35410 PE=1 SV=1
11	Q9Y4C8	2.80e-16	85.9	960	0.074	0.058	RBM19_HUMAN Probable RNA-binding protein 19 OS=Homo sapiens OX=9606 GN=RBM19 PE=1 SV=3
12	O13845	8.00e-15	80.5	603	0.074	0.093	RSD1_SCHPO RNA-binding protein rsd1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rsd1 PE=1 SV=2
13	F1QF98	9.42e-15	80.9	927	0.086	0.070	F1QF98_DANRE Probable RNA-binding protein 19 OS=Danio rerio OX=7955 GN=npo PE=1 SV=1
14	Q9ZUU4	1.34e-14	77.4	289	0.074	0.194	CP29B_ARATH RNA-binding protein CP29B, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CP29B PE=1 SV=1
15	Q9XU67	1.37e-14	80.1	872	0.095	0.083	Q9XU67_CAEEL RRM domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=rbd-1 PE=1 SV=1
16	F4ILE1	2.44e-14	79.0	610	0.074	0.092	F4ILE1_ARATH Splicing factor, CC1-like protein OS=Arabidopsis thaliana OX=3702 GN=At2g16940 PE=1 SV=1
17	Q04836	2.72e-14	77.0	329	0.066	0.152	CP31A_ARATH 31 kDa ribonucleoprotein, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CP31A PE=1 SV=1
18	Q9FXA2	7.99e-14	77.4	671	0.076	0.086	PABP8_ARATH Polyadenylate-binding protein 8 OS=Arabidopsis thaliana OX=3702 GN=PAB8 PE=1 SV=1
19	H0Y5F5	1.25e-13	76.6	550	0.078	0.107	H0Y5F5_HUMAN Polyadenylate-binding protein (Fragment) OS=Homo sapiens OX=9606 GN=PABPC4 PE=1 SV=1
20	Q13310	2.04e-13	76.3	644	0.078	0.092	PABP4_HUMAN Polyadenylate-binding protein 4 OS=Homo sapiens OX=9606 GN=PABPC4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16459 Phage_TAC_13	1.6e+02	14.1	Phage tail assembly chaperone, TAC
2	PF00076 RRM_1	4.4e-53	188.3	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
3	PF16367 RRM_7	0.023	26.1	RNA recognition motif
4	PF16842 RRM_occluded	2.3	19.5	Occluded RNA-recognition motif

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000223073

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000358812	0.998	Protein RRP5 homolog
2	9606.ENSP00000371858	0.995	Probable 28S rRNA (cytosine(4447)-C(5))-methyltransferase
3	9606.ENSP00000327179	0.994	U3 small nucleolar RNA-associated protein 4 homolog
4	9606.ENSP00000363642	0.994	Ribosome biogenesis protein BMS1 homolog
5	9606.ENSP00000247003	0.993	Probable ATP-dependent RNA helicase DDX49
6	9606.ENSP00000261708	0.993	U3 small nucleolar RNA-associated protein 6 homolog
7	9606.ENSP00000384302	0.993	WD repeat-containing protein 43
8	9606.ENSP00000259239	0.992	U3 small nucleolar ribonucleoprotein protein IMP4
9	9606.ENSP00000264279	0.992	Nucleolar protein 58
10	9606.ENSP00000285814	0.992	Nucleolar protein interacting with the FHA domain of MKI67
11	9606.ENSP00000370589	0.992	Nucleolar protein 56
12	9606.ENSP00000405068	0.992	Nucleolar protein 14
13	9606.ENSP00000254803	0.990	Something about silencing protein 10
14	9606.ENSP00000423067	0.990	WD repeat-containing protein 36
15	9606.ENSP00000454836	0.990	Transducin beta-like protein 3
16	9606.ENSP00000355541	0.989	HEAT repeat-containing protein 1
17	9606.ENSP00000363746	0.989	WD repeat-containing protein 46
18	9606.ENSP00000428619	0.989	U3 small nucleolar RNA-associated protein 14 homolog C
19	9606.ENSP00000308179	0.988	WD repeat-containing protein 3
20	9606.ENSP00000311135	0.988	Probable ATP-dependent RNA helicase DHX37

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003723	1.000	RNA binding
GO:0005515	0.996	protein binding
GO:0003729	0.906	mRNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.996	organic substance metabolic process
GO:0044238	0.996	primary metabolic process
GO:0044237	0.996	cellular metabolic process
GO:0043170	0.993	macromolecule metabolic process
GO:0034641	0.989	cellular nitrogen compound metabolic process
GO:0006139	0.977	nucleobase-containing compound metabolic process
GO:0034660	0.967	ncRNA metabolic process
GO:0065007	0.966	biological regulation
GO:0050789	0.960	regulation of biological process
GO:0010467	0.959	gene expression
GO:0016072	0.914	rRNA metabolic process
GO:0034470	0.903	ncRNA processing
GO:0022613	0.860	ribonucleoprotein complex biogenesis
GO:0042254	0.839	ribosome biogenesis
GO:0050794	0.771	regulation of cellular process
GO:0019222	0.609	regulation of metabolic process
GO:0060255	0.574	regulation of macromolecule metabolic process
GO:0048518	0.473	positive regulation of biological process
GO:0010468	0.461	regulation of gene expression
GO:0080090	0.450	regulation of primary metabolic process
GO:0031323	0.442	regulation of cellular metabolic process
GO:0051171	0.408	regulation of nitrogen compound metabolic process
GO:0019219	0.309	regulation of nucleobase-containing compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005730	1.000	nucleolus
GO:0005654	0.930	nucleoplasm
GO:0005737	0.760	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]