StarFunc result for job id Q9NW81

User Input

>input (257 residues)
MAAPWASLRLVAPMWNGRIRGIHRLGAAVAPEGNQKKKRTILQFLTNYFYDVEALRDYLL
QREMYKVHEKNRSYTWLEKQHGPYGAGAFFILKQGGAVKFRDKEWIRPDKYGHFSQEFWN
FCEVPVEAVDAGDCDINYEGLDNLLRLKELQSLSLQRCCHVDDWCLSRLYPLADSLQELS
LAGCPRISERGLACLHHLQNLRRLDISDLPAVSNPGLTQILVEEMLPNCEVVGVDWAEGL
KSGPEEQPRDTASPVPA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NW81	1.000	1.000	2.284E-51	257	1.000	1.000	Q9NW81.pdb.gz	DMAC2_HUMAN Distal membrane-arm assembly complex protein 2 OS=Homo sapiens OX=9606 GN=DMAC2 PE=1 SV=3
2	AFDB:Q9D7K5	0.758	0.756	4.103E-33	258	0.673	0.671	Q9D7K5.pdb.gz	DMAC2_MOUSE Distal membrane-arm assembly complex protein 2 OS=Mus musculus OX=10090 GN=Dmac2 PE=1 SV=1
3	AFDB:Q9N3G1	0.691	0.400	2.315E-17	455	0.233	0.132	Q9N3G1.pdb.gz	Q9N3G1_CAEEL Mitochondrial ATP synthase regulatory component factor B OS=Caenorhabditis elegans OX=6239 GN=CELE_Y53G8AR.8 PE=1 SV=3
4	AFDB:Q9CRA7	0.574	0.727	3.078E-15	200	0.191	0.245	Q9CRA7.pdb.gz	ATP5S_MOUSE ATP synthase subunit s, mitochondrial OS=Mus musculus OX=10090 GN=Dmac2l PE=1 SV=1
5	AFDB:Q99766	0.588	0.695	9.010E-14	215	0.191	0.228	Q99766.pdb.gz	ATP5S_HUMAN ATP synthase subunit s, mitochondrial OS=Homo sapiens OX=9606 GN=DMAC2L PE=1 SV=3
6	AFDB:Q5MJ12	0.355	0.192	5.700E-7	479	0.136	0.073	Q5MJ12.pdb.gz	FXL16_RAT F-box/LRR-repeat protein 16 OS=Rattus norvegicus OX=10116 GN=Fbxl16 PE=2 SV=1
7	AFDB:A8DYA6	0.372	0.151	6.404E-7	651	0.121	0.048	A8DYA6.pdb.gz	A8DYA6_DROME Uncharacterized protein, isoform B OS=Drosophila melanogaster OX=7227 GN=Dmel\CG9003 PE=4 SV=1
8	AFDB:P34284	0.364	0.204	9.081E-7	466	0.128	0.071	P34284.pdb.gz	FBXL_CAEEL F-box/LRR-repeat protein fbxl-1 OS=Caenorhabditis elegans OX=6239 GN=fbxl-1 PE=2 SV=3
9	AFDB:Q5BJ29	0.385	0.206	9.626E-7	491	0.113	0.059	Q5BJ29.pdb.gz	FBXL7_MOUSE F-box/LRR-repeat protein 7 OS=Mus musculus OX=10090 GN=Fbxl7 PE=1 SV=1
10	AFDB:Q96IG2	0.394	0.235	2.443E-6	436	0.121	0.071	Q96IG2.pdb.gz	FXL20_HUMAN F-box/LRR-repeat protein 20 OS=Homo sapiens OX=9606 GN=FBXL20 PE=1 SV=2
11	PDB:6o60C	0.340	0.227	9.338E-5	389	0.105	0.069	6o60C.pdb.gz	GGTase3 is a newly identified geranylgeranyltransferase targeting a ubiquitin ligase.
12	PDB:4i6jB	0.271	0.186	4.497E-4	394	0.097	0.063	4i6jB.pdb.gz
13	PDB:7pmkL	0.364	0.210	5.052E-4	475	0.097	0.053	7pmkL.pdb.gz	A conserved mechanism for regulating replisome disassembly in eukaryotes.
14	PDB:5xjxC	0.265	0.194	1.818E-3	365	0.105	0.074	5xjxC.pdb.gz
15	PDB:7b5mT	0.324	0.260	1.927E-3	325	0.101	0.080	7b5mT.pdb.gz	Ubiquitin ligation to F-box protein targets by SCF-RBR E3-E3 super-assembly.
16	PDB:6hkwA	0.284	0.242	1.105E-2	306	0.062	0.052	6hkwA.pdb.gz
17	PDB:1a4yA	0.338	0.196	1.242E-2	460	0.093	0.052	1a4yA.pdb.gz
18	PDB:3oglB	0.327	0.154	1.761E-2	568	0.082	0.037	3oglB.pdb.gz	Jasmonate perception by inositol-phosphate-potentiated COI1-JAZ co-receptor.
19	PDB:4kxfP	0.285	0.093	1.761E-2	866	0.078	0.023	4kxfP.pdb.gz	Crystal structure of NLRC4 reveals its autoinhibition mechanism
20	PDB:7sa1B	0.242	0.105	2.223E-2	624	0.074	0.030	7sa1B.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9NW81	0.0	534	257	1.000	1.000	DMAC2_HUMAN Distal membrane-arm assembly complex protein 2 OS=Homo sapiens OX=9606 GN=DMAC2 PE=1 SV=3
2	Q9D7K5	2.88e-124	355	258	0.673	0.671	DMAC2_MOUSE Distal membrane-arm assembly complex protein 2 OS=Mus musculus OX=10090 GN=Dmac2 PE=1 SV=1
3	Q9N3G1	1.47e-27	112	455	0.226	0.127	Q9N3G1_CAEEL Mitochondrial ATP synthase regulatory component factor B OS=Caenorhabditis elegans OX=6239 GN=CELE_Y53G8AR.8 PE=1 SV=3
4	Q9CRA7	5.75e-13	67.8	200	0.167	0.215	ATP5S_MOUSE ATP synthase subunit s, mitochondrial OS=Mus musculus OX=10090 GN=Dmac2l PE=1 SV=1
5	Q99766	2.08e-12	66.6	215	0.160	0.191	ATP5S_HUMAN ATP synthase subunit s, mitochondrial OS=Homo sapiens OX=9606 GN=DMAC2L PE=1 SV=3
6	Q5MJ12	2.50e-04	44.3	479	0.144	0.077	FXL16_RAT F-box/LRR-repeat protein 16 OS=Rattus norvegicus OX=10116 GN=Fbxl16 PE=2 SV=1
7	Q8RWU5	3.82e-04	43.9	665	0.128	0.050	FBL3_ARATH F-box/LRR-repeat protein 3 OS=Arabidopsis thaliana OX=3702 GN=FBL3 PE=2 SV=1
8	D3ZS59	0.002	40.8	236	0.136	0.148	D3ZS59_RAT F-box and leucine-rich repeat protein 22 OS=Rattus norvegicus OX=10116 GN=Fbxl22 PE=4 SV=1
9	Q8NEE6	0.003	41.2	735	0.163	0.057	FXL13_HUMAN F-box and leucine-rich repeat protein 13 OS=Homo sapiens OX=9606 GN=FBXL13 PE=2 SV=3
10	Q57XT1	0.005	40.4	743	0.093	0.032	Q57XT1_TRYB2 Leucine-rich repeat protein (LRRP), putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.21H15.270 PE=4 SV=1
11	Q9N946	0.006	40.4	1448	0.121	0.021	Q9N946_TRYB2 Leucine-rich repeat protein (LRRP), putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.370 PE=4 SV=1
12	Q6TGX5	0.008	39.7	411	0.125	0.078	Q6TGX5_DANRE F-box and leucine-rich repeat protein 14a OS=Danio rerio OX=7955 GN=wu:fi25d04 PE=2 SV=1
13	Q4GY77	0.014	38.9	735	0.148	0.052	Q4GY77_TRYB2 Leucine-rich repeat protein (LRRP), putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=TB927.1.5030 PE=4 SV=1
14	Q57XT8	0.014	38.9	645	0.093	0.037	Q57XT8_TRYB2 Leucine-rich repeat protein (LRRP), putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.21H15.150 PE=4 SV=1
15	Q9SKK0	0.018	38.5	628	0.089	0.037	EBF1_ARATH EIN3-binding F-box protein 1 OS=Arabidopsis thaliana OX=3702 GN=EBF1 PE=1 SV=1
16	Q5SWA1	0.022	38.5	713	0.086	0.031	PR15B_HUMAN Protein phosphatase 1 regulatory subunit 15B OS=Homo sapiens OX=9606 GN=PPP1R15B PE=1 SV=2
17	Q5RH13	0.025	38.1	400	0.101	0.065	Q5RH13_DANRE F-box and leucine-rich repeat protein 14b OS=Danio rerio OX=7955 GN=fbxl14 PE=2 SV=1
18	Q9SMY8	0.028	38.1	990	0.086	0.022	FBL15_ARATH F-box/LRR-repeat protein 15 OS=Arabidopsis thaliana OX=3702 GN=FBL15 PE=2 SV=2
19	Q6PCT2	0.031	37.7	694	0.089	0.033	FXL19_HUMAN F-box/LRR-repeat protein 19 OS=Homo sapiens OX=9606 GN=FBXL19 PE=1 SV=3
20	Q6PB97	0.032	37.7	674	0.089	0.034	FXL19_MOUSE F-box/LRR-repeat protein 19 OS=Mus musculus OX=10090 GN=Fbxl19 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF10472 CReP_N	18	15.6	eIF2-alpha phosphatase phosphorylation constitutive repressor
2	PF00560 LRR_1	3.7e+02	13.1	Leucine Rich Repeat
3	PF12799 LRR_4	12	17.7	Leucine Rich repeats (2 copies)
4	PF13516 LRR_6	0.85	20.9	Leucine Rich repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000403910

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000272643	0.645	Thrombospondin type-1 domain-containing protein 7B
2	9606.ENSP00000385739	0.638	Carcinoembryonic antigen related cell adhesion molecule family
3	9606.ENSP00000432692	0.636	Ubiquinol-cytochrome-c reductase complex assembly factor 3
4	9606.ENSP00000445920	0.634	Cob(I)yrinic acid a,c-diamide adenosyltransferase, mitochondrial
5	9606.ENSP00000449884	0.608	Mitochondrial ribosomal protein L42
6	9606.ENSP00000311760	0.600	Belongs to the TTC9 family
7	9606.ENSP00000363506	0.594	Ubiquinol-cytochrome-c reductase complex assembly factor 1
8	9606.ENSP00000479518	0.576	Unconventional myosin-XIX
9	9606.ENSP00000387535	0.574	Immunity-related GTPase family Q protein
10	9606.ENSP00000321810	0.571	tRNA dimethylallyltransferase
11	9606.ENSP00000243563	0.568	U1 small nuclear ribonucleoprotein A
12	9606.ENSP00000348033	0.553	Olfactory receptor 11L1
13	9606.ENSP00000361923	0.541	Mitochondrial coiled-coil-helix-coiled-coil-helix domain containing proteins
14	9606.ENSP00000269373	0.530	Ketosamine-3-kinase
15	9606.ENSP00000320416	0.525	Vacuolar protein sorting-associated protein 37D
16	9606.ENSP00000369897	0.521	Cysteine--tRNA ligase, cytoplasmic
17	9606.ENSP00000378405	0.521	[3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kinase, mitochondrial
18	9606.ENSP00000297071	0.511	Transformer-2 protein homolog alpha
19	9606.ENSP00000475473	0.506	Protein Churchill

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0032981	0.992	mitochondrial respiratory chain complex I assembly
GO:0008152	0.708	metabolic process
GO:0071704	0.502	organic substance metabolic process
GO:0044238	0.461	primary metabolic process
GO:0006807	0.413	nitrogen compound metabolic process
GO:0044237	0.303	cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	0.999	mitochondrion
GO:0016020	0.998	membrane
GO:0032991	0.992	protein-containing complex
GO:0005743	0.987	mitochondrial inner membrane
GO:0098798	0.979	mitochondrial protein-containing complex
GO:1902494	0.975	catalytic complex
GO:0098796	0.974	membrane protein complex
GO:0098800	0.883	inner mitochondrial membrane protein complex
GO:1990204	0.829	oxidoreductase complex
GO:0098803	0.821	respiratory chain complex
GO:0005746	0.821	mitochondrial respirasome
GO:1902495	0.776	transmembrane transporter complex
GO:0005747	0.770	mitochondrial respiratory chain complex I

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]