StarFunc result for job id Q9NWB7

User Input

>input (429 residues)
MTAALAVVTTSGLEDGVPRSRGEGTGEVVLERGPGAAYHMFVVMEDLVEKLKLLRYEEEF
LRKSNLKAPSRHYFALPTNPGEQFYMFCTLAAWLINKAGRPFEQPQEYDDPNATISNILS
ELRSFGRTADFPPSKLKSGYGEHVCYVLDCFAEEALKYIGFTWKRPIYPVEELEEESVAE
DDAELTLNKVDEEFVEEETDNEENFIDLNVLKAQTYHLDMNETAKQEDILESTTDAAEWS
LEVERVLPQLKVTIRTDNKDWRIHVDQMHQHRSGIESALKETKGFLDKLHNEITRTLEKI
SSREKYINNQLENLVQEYRAAQAQLSEAKERYQQGNGGVTERTRLLSEVMEELEKVKQEM
EEKGSSMTDGAPLVKIKQSLTKLKQETVEMDIRIGIVEHTLLQSKLKEKSNMTRNMHATV
IPEPATGFY

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8BXG3	0.475	0.475	7.919E-52	429	0.907	0.907	Q8BXG3.pdb.gz	IFT57_MOUSE Intraflagellar transport protein 57 homolog OS=Mus musculus OX=10090 GN=Ift57 PE=1 SV=1
2	AFDB:Q6IVW0	0.462	0.484	4.796E-36	407	0.608	0.641	Q6IVW0.pdb.gz	IFT57_DANRE Intraflagellar transport protein 57 homolog OS=Danio rerio OX=7955 GN=ift57 PE=2 SV=1
3	AFDB:Q93833	0.365	0.380	2.667E-26	412	0.368	0.383	Q93833.pdb.gz	CHE13_CAEEL Intraflagellar transport protein che-13 OS=Caenorhabditis elegans OX=6239 GN=che-13 PE=1 SV=2
4	AFDB:Q389K8	0.344	0.357	4.698E-17	413	0.277	0.288	Q389K8.pdb.gz	Q389K8_TRYB2 Intraflagellar transport protein 57/55 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.26.0670 PE=3 SV=1
5	AFDB:Q99871	0.184	0.208	9.053E-3	368	0.131	0.152	Q99871.pdb.gz	HAUS7_HUMAN HAUS augmin-like complex subunit 7 OS=Homo sapiens OX=9606 GN=HAUS7 PE=1 SV=4
6	AFDB:Q8R3P7	0.207	0.214	1.844E-2	413	0.124	0.128	Q8R3P7.pdb.gz	CLUA1_MOUSE Clusterin-associated protein 1 OS=Mus musculus OX=10090 GN=Cluap1 PE=1 SV=1
7	AFDB:Q22505	0.142	0.095	3.556E-2	679	0.161	0.102	Q22505.pdb.gz	IMMT1_CAEEL MICOS complex subunit MIC60-1 OS=Caenorhabditis elegans OX=6239 GN=immt-1 PE=2 SV=2
8	AFDB:Q8AWF5	0.208	0.147	4.191E-2	638	0.138	0.092	Q8AWF5.pdb.gz	NDC80_XENLA Kinetochore protein NDC80 homolog OS=Xenopus laevis OX=8355 GN=ndc80 PE=1 SV=2
9	AFDB:F1SBC5	0.213	0.155	7.244E-2	616	0.117	0.081	F1SBC5.pdb.gz
10	AFDB:Q10198	0.195	0.140	8.537E-2	624	0.131	0.090	Q10198.pdb.gz	NDC80_SCHPO Kinetochore protein ndc80 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ndc80 PE=1 SV=1
11	PDB:2l3yA	0.108	0.204	3.502E-1	184	0.047	0.109	2l3yA.pdb.gz
12	PDB:7sqkE	0.125	0.093	4.359E-1	610	0.128	0.090	7sqkE.pdb.gz
13	PDB:7z0lB	0.088	0.097	5.137E-1	370	0.042	0.049	7z0lB.pdb.gz
14	PDB:3dbrG	0.075	0.065	1.233	508	0.049	0.041	3dbrG.pdb.gz	Structural dissection of a gating mechanism preventing misactivation of ubiquitin by NEDD8's E1.
15	PDB:6mzlA	0.070	0.065	1.233	472	0.035	0.032	6mzlA.pdb.gz
16	PDB:7oggR	0.087	0.083	1.302	458	0.054	0.050	7oggR.pdb.gz
17	PDB:3aqbD	0.089	0.109	1.376	325	0.040	0.052	3aqbD.pdb.gz	Crystal structure of heterodimeric hexaprenyl diphosphate synthase from Micrococcus luteus B-P 26 reveals that the small subunit is directly involved in the product chain length regulation.
18	PDB:1yo7A	0.085	0.222	1.621	120	0.044	0.158	1yo7A.pdb.gz	Structure of the ColE1 rop protein at 1.7 A resolution
19	PDB:2pbeA	0.104	0.153	1.809	263	0.058	0.095	2pbeA.pdb.gz
20	PDB:6al2A	0.098	0.088	1.910	484	0.040	0.035	6al2A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6IVW0	0.0	524	407	0.611	0.644	IFT57_DANRE Intraflagellar transport protein 57 homolog OS=Danio rerio OX=7955 GN=ift57 PE=2 SV=1
2	Q8BXG3	0.0	788	429	0.907	0.907	IFT57_MOUSE Intraflagellar transport protein 57 homolog OS=Mus musculus OX=10090 GN=Ift57 PE=1 SV=1
3	Q9NWB7	0.0	889	429	1.000	1.000	IFT57_HUMAN Intraflagellar transport protein 57 homolog OS=Homo sapiens OX=9606 GN=IFT57 PE=1 SV=1
4	Q93833	1.01e-99	305	412	0.364	0.379	CHE13_CAEEL Intraflagellar transport protein che-13 OS=Caenorhabditis elegans OX=6239 GN=che-13 PE=1 SV=2
5	Q389K8	1.85e-56	193	413	0.284	0.295	Q389K8_TRYB2 Intraflagellar transport protein 57/55 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.26.0670 PE=3 SV=1
6	Q8I5K3	0.029	39.3	2329	0.098	0.018	Q8I5K3_PLAF7 Histone-lysine N-methyltransferase, H3 lysine-4 specific OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1221000 PE=4 SV=1
7	Q02224	0.044	38.9	2701	0.131	0.021	CENPE_HUMAN Centromere-associated protein E OS=Homo sapiens OX=9606 GN=CENPE PE=1 SV=2
8	Q387G4	0.24	36.2	948	0.093	0.042	Q387G4_TRYB2 Leucine-rich repeat protein (LRRP) OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.03.0280 PE=4 SV=1
9	Q2Q1W5	0.37	35.8	3664	0.128	0.015	Q2Q1W5_DANRE Laminin alpha 5 OS=Danio rerio OX=7955 GN=wu:fb81a10 PE=1 SV=1
10	B3RH40	0.72	34.7	1255	0.058	0.020	B3RH40_MEDTR Myosin heavy chain-like protein, putative OS=Medicago truncatula OX=3880 GN=25484843 PE=4 SV=1
11	O13290	0.77	34.7	4196	0.068	0.007	DYHC_SCHPO Dynein heavy chain, cytoplasmic OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=dhc1 PE=1 SV=1
12	Q6RT24	0.96	34.7	2474	0.070	0.012	CENPE_MOUSE Centromere-associated protein E OS=Mus musculus OX=10090 GN=Cenpe PE=1 SV=1
13	Q9UT24	1.6	33.9	2176	0.091	0.018	BRR2_SCHPO Pre-mRNA-splicing factor brr2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=brr2 PE=1 SV=1
14	Q8I4T3	4.6	32.3	3119	0.047	0.006	Q8I4T3_PLAF7 Osmiophilic body protein G377 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1250100 PE=4 SV=1
15	Q9H993	4.7	32.0	441	0.051	0.050	ARMT1_HUMAN Damage-control phosphatase ARMT1 OS=Homo sapiens OX=9606 GN=ARMT1 PE=1 SV=1
16	Q9VCD1	4.8	32.3	2048	0.103	0.021	Q9VCD1_DROME Rootletin, isoform D OS=Drosophila melanogaster OX=7227 GN=Root PE=4 SV=3
17	Q6DT37	7.1	31.6	1551	0.058	0.016	MRCKG_HUMAN Serine/threonine-protein kinase MRCK gamma OS=Homo sapiens OX=9606 GN=CDC42BPG PE=1 SV=2
18	Q8IZ41	8.0	31.2	740	0.100	0.058	RASEF_HUMAN Ras and EF-hand domain-containing protein OS=Homo sapiens OX=9606 GN=RASEF PE=1 SV=1
19	Q8MSN3	8.0	31.6	1230	0.103	0.036	Q8MSN3_DROME AT16851p OS=Drosophila melanogaster OX=7227 GN=Root PE=2 SV=1
20	Q20357	9.9	31.2	853	0.054	0.027	Q20357_CAEEL Myosin motor domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=hum-10 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF18053 GyrB_insert	7.3e+02	11.4	DNA gyrase B subunit insert domain
2	PF10498 IFT57	7.6e-145	494.0	Intra-flagellar transport protein 57
3	PF00015 MCPsignal	85	14.4	Methyl-accepting chemotaxis protein (MCP) signalling domain
4	PF01042 Ribonuc_L-PSP	7.7e+02	11.5	Endoribonuclease L-PSP
5	PF18052 Rx_N	9.1e+02	11.5	Rx N-terminal domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000264538

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000312778	0.999	Intraflagellar transport protein 80 homolog
2	9606.ENSP00000323580	0.999	Intraflagellar transport protein 88 homolog
3	9606.ENSP00000464443	0.999	Intraflagellar transport protein 20 homolog
4	9606.ENSP00000362121	0.998	Intraflagellar transport protein 52 homolog
5	9606.ENSP00000260570	0.997	Intraflagellar transport protein 172 homolog
6	9606.ENSP00000362424	0.997	TRAF3-interacting protein 1
7	9606.ENSP00000404122	0.995	Intraflagellar transport protein 74 homolog
8	9606.ENSP00000460850	0.995	Clusterin-associated protein 1
9	9606.ENSP00000242591	0.994	Intraflagellar transport protein 81 homolog
10	9606.ENSP00000264020	0.994	Intraflagellar transport proteins
11	9606.ENSP00000386181	0.987	Tetratricopeptide repeat protein 30B
12	9606.ENSP00000419279	0.987	Intraflagellar transport protein 56
13	9606.ENSP00000320359	0.983	Intraflagellar transport protein 22 homolog
14	9606.ENSP00000347184	0.982	Huntingtin
15	9606.ENSP00000351273	0.978	Caspase-8
16	9606.ENSP00000406012	0.970	Intraflagellar transport protein 140 homolog
17	9606.ENSP00000393541	0.967	Intraflagellar transport protein 27 homolog
18	9606.ENSP00000347915	0.965	Tetratricopeptide repeat protein 30A
19	9606.ENSP00000296266	0.957	Intraflagellar transport protein 122 homolog
20	9606.ENSP00000194214	0.952	Intraflagellar transport protein 25 homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.988	cellular process
GO:0050794	0.977	regulation of cellular process
GO:0016043	0.958	cellular component organization
GO:0060271	0.939	cilium assembly
GO:0032501	0.911	multicellular organismal process
GO:0031503	0.899	protein-containing complex localization
GO:0010970	0.892	transport along microtubule
GO:0042073	0.865	intraciliary transport
GO:0019222	0.835	regulation of metabolic process
GO:0045862	0.806	positive regulation of proteolysis
GO:0032502	0.798	developmental process
GO:0052547	0.794	regulation of peptidase activity
GO:0048856	0.790	anatomical structure development
GO:2001056	0.759	positive regulation of cysteine-type endopeptidase activity
GO:0007275	0.753	multicellular organism development
GO:0051716	0.748	cellular response to stimulus
GO:0043281	0.717	regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0043280	0.695	positive regulation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0009653	0.670	anatomical structure morphogenesis
GO:0007399	0.649	nervous system development
GO:0006919	0.643	activation of cysteine-type endopeptidase activity involved in apoptotic process
GO:1905515	0.629	non-motile cilium assembly
GO:0010941	0.625	regulation of cell death
GO:0007154	0.553	cell communication
GO:0007389	0.516	pattern specification process
GO:0048513	0.514	animal organ development
GO:0048519	0.503	negative regulation of biological process
GO:0023052	0.496	signaling
GO:0007165	0.489	signal transduction
GO:0048523	0.482	negative regulation of cellular process
GO:0060972	0.473	left/right pattern formation
GO:0009799	0.456	specification of symmetry
GO:0008219	0.411	cell death
GO:0009887	0.400	animal organ morphogenesis
GO:0007166	0.390	cell surface receptor signaling pathway
GO:0009888	0.375	tissue development
GO:0035295	0.365	tube development
GO:0042127	0.334	regulation of cell population proliferation
GO:0007368	0.326	determination of left/right symmetry
GO:0048522	0.320	positive regulation of cellular process
GO:0048729	0.319	tissue morphogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0030992	0.999	intraciliary transport particle B
GO:0043232	0.996	intracellular non-membrane-bounded organelle
GO:0032391	0.995	photoreceptor connecting cilium
GO:0012505	0.994	endomembrane system
GO:0005737	0.990	cytoplasm
GO:0005815	0.967	microtubule organizing center
GO:0043231	0.955	intracellular membrane-bounded organelle
GO:0097542	0.952	ciliary tip
GO:0005813	0.949	centrosome
GO:0005794	0.775	Golgi apparatus
GO:0036064	0.645	ciliary basal body
GO:0005829	0.624	cytosol
GO:0097546	0.441	ciliary base
GO:0016020	0.440	membrane
GO:0099568	0.425	cytoplasmic region
GO:0031981	0.422	nuclear lumen
GO:0097014	0.414	ciliary plasm
GO:0005930	0.401	axoneme
GO:0036477	0.347	somatodendritic compartment
GO:0030425	0.318	dendrite

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]