StarFunc result for job id Q9NWF4

User Input

>input (448 residues)
MAAPTLGRLVLTHLLVALFGMGSWAAVNGIWVELPVVVKDLPEGWSLPSYLSVVVALGNL
GLLVVTLWRQLAPGKGEQVPIQVVQVLSVVGTALLAPLWHHVAPVAGQLHSVAFLTLALV
LAMACCTSNVTFLPFLSHLPPPFLRSFFLGQGLSALLPCVLALVQGVGRLECPPAPTNGT
SGPPLDFPERFPASTFFWALTALLVTSAAAFRGLLLLLPSLPSVTTGGSGPELQLGSPGA
EEEEKEEEEALPLQEPPSQAAGTIPGPDPEAHQLFSAHGAFLLGLMAFTSAVTNGVLPSV
QSFSCLPYGRLAYHLAVVLGSAANPLACFLAMGVLCRSLAGLVGLSLLGMLFGAYLMALA
ILSPCPPLVGTTAGVVLVVLSWVLCLCVFSYVKVAASSLLHGGGRPALLAAGVAIQVGSL
LGAGAMFPPTSIYHVFQSRKDCVDPCGP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NWF4	1.000	1.000	1.050E-59	448	1.000	1.000	Q9NWF4.pdb.gz	S52A1_HUMAN Solute carrier family 52, riboflavin transporter, member 1 OS=Homo sapiens OX=9606 GN=SLC52A1 PE=1 SV=2
2	AFDB:B5MEV3	0.913	0.909	5.570E-49	450	0.804	0.800	B5MEV3.pdb.gz	S52A2_RAT Solute carrier family 52, riboflavin transporter, member 2 OS=Rattus norvegicus OX=10116 GN=Slc52a2 PE=2 SV=2
3	AFDB:Q9HAB3	0.785	0.790	5.861E-46	445	0.862	0.867	Q9HAB3.pdb.gz	S52A2_HUMAN Solute carrier family 52, riboflavin transporter, member 2 OS=Homo sapiens OX=9606 GN=SLC52A2 PE=1 SV=1
4	AFDB:Q4FZU9	0.822	0.796	3.956E-30	463	0.426	0.413	Q4FZU9.pdb.gz	S52A3_RAT Solute carrier family 52, riboflavin transporter, member 3 OS=Rattus norvegicus OX=10116 GN=Slc52a3 PE=1 SV=1
5	AFDB:Q9NQ40	0.818	0.782	3.264E-28	469	0.424	0.405	Q9NQ40.pdb.gz	S52A3_HUMAN Solute carrier family 52, riboflavin transporter, member 3 OS=Homo sapiens OX=9606 GN=SLC52A3 PE=1 SV=4
6	AFDB:Q3LFN0	0.802	0.840	2.899E-25	427	0.315	0.330	Q3LFN0.pdb.gz	S52AA_CAEEL Riboflavin transporter rft-1 OS=Caenorhabditis elegans OX=6239 GN=rft-1 PE=1 SV=2
7	AFDB:Q9V9S9	0.805	0.743	7.066E-25	487	0.335	0.308	Q9V9S9.pdb.gz	Q9V9S9_DROME Riboflavin transporter OS=Drosophila melanogaster OX=7227 GN=Rift PE=3 SV=3
8	AFDB:G4SDH4	0.688	0.652	3.283E-21	476	0.297	0.279	G4SDH4.pdb.gz	S52AB_CAEEL Riboflavin transporter rft-2 OS=Caenorhabditis elegans OX=6239 GN=rft-2 PE=1 SV=2
9	AFDB:Q99PL8	0.517	0.482	7.208E-8	488	0.165	0.152	Q99PL8.pdb.gz	S19A3_MOUSE Thiamine transporter 2 OS=Mus musculus OX=10090 GN=Slc19a3 PE=1 SV=2
10	AFDB:Q8R139	0.549	0.478	1.150E-7	528	0.156	0.133	Q8R139.pdb.gz	S29A4_MOUSE Equilibrative nucleoside transporter 4 OS=Mus musculus OX=10090 GN=Slc29a4 PE=1 SV=1
11	PDB:7dl9A	0.526	0.571	9.469E-6	405	0.143	0.158	7dl9A.pdb.gz
12	PDB:6ob6B	0.522	0.629	1.171E-5	357	0.127	0.160	6ob6B.pdb.gz	Structures of human ENT1 in complex with adenosine reuptake inhibitors.
13	PDB:6ob7A	0.509	0.581	1.330E-5	381	0.129	0.152	6ob7A.pdb.gz	Structures of human ENT1 in complex with adenosine reuptake inhibitors.
14	PDB:4u4tA	0.461	0.464	7.258E-5	444	0.136	0.137	4u4tA.pdb.gz	Structural basis for dynamic mechanism of nitrate/nitrite antiport by NarK
15	PDB:6oopA	0.538	0.602	8.244E-5	392	0.132	0.151	6oopA.pdb.gz	Structure of an engineered multidrug transporter MdfA reveals the molecular basis for substrate recognition.
16	PDB:6thaA	0.509	0.509	1.625E-4	448	0.138	0.138	6thaA.pdb.gz
17	PDB:4q65A	0.507	0.518	1.926E-4	437	0.125	0.128	4q65A.pdb.gz
18	PDB:4iu9A	0.500	0.552	2.592E-4	396	0.132	0.149	4iu9A.pdb.gz
19	PDB:7wsmA	0.539	0.523	3.798E-4	464	0.158	0.153	7wsmA.pdb.gz	Cryo-EM structure of human glucose transporter GLUT4.
20	PDB:7c76B	0.468	0.442	4.313E-4	483	0.150	0.139	7c76B.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B5MEV3	0.0	627	450	0.801	0.798	S52A2_RAT Solute carrier family 52, riboflavin transporter, member 2 OS=Rattus norvegicus OX=10116 GN=Slc52a2 PE=2 SV=2
2	Q9HAB3	0.0	647	445	0.862	0.867	S52A2_HUMAN Solute carrier family 52, riboflavin transporter, member 2 OS=Homo sapiens OX=9606 GN=SLC52A2 PE=1 SV=1
3	Q9NWF4	0.0	864	448	1.000	1.000	S52A1_HUMAN Solute carrier family 52, riboflavin transporter, member 1 OS=Homo sapiens OX=9606 GN=SLC52A1 PE=1 SV=2
4	Q9D6X5	2.95e-95	296	460	0.444	0.433	S52A3_MOUSE Solute carrier family 52, riboflavin transporter, member 3 OS=Mus musculus OX=10090 GN=Slc52a3 PE=1 SV=3
5	Q4FZU9	3.19e-95	296	463	0.453	0.438	S52A3_RAT Solute carrier family 52, riboflavin transporter, member 3 OS=Rattus norvegicus OX=10116 GN=Slc52a3 PE=1 SV=1
6	Q9NQ40	7.23e-90	282	469	0.435	0.416	S52A3_HUMAN Solute carrier family 52, riboflavin transporter, member 3 OS=Homo sapiens OX=9606 GN=SLC52A3 PE=1 SV=4
7	Q9V9S9	1.87e-71	235	487	0.344	0.316	Q9V9S9_DROME Riboflavin transporter OS=Drosophila melanogaster OX=7227 GN=Rift PE=3 SV=3
8	Q3LFN0	6.47e-55	190	427	0.315	0.330	S52AA_CAEEL Riboflavin transporter rft-1 OS=Caenorhabditis elegans OX=6239 GN=rft-1 PE=1 SV=2
9	Q8SYL6	6.41e-51	179	395	0.257	0.291	Q8SYL6_DROME Riboflavin transporter OS=Drosophila melanogaster OX=7227 GN=Rift PE=2 SV=1
10	G4SDH4	2.78e-40	152	476	0.304	0.286	S52AB_CAEEL Riboflavin transporter rft-2 OS=Caenorhabditis elegans OX=6239 GN=rft-2 PE=1 SV=2
11	A9CGF9	1.5	33.9	1159	0.060	0.023	A9CGF9_AGRFC IcmF family protein OS=Agrobacterium fabrum (strain C58 / ATCC 33970) OX=176299 GN=impL PE=1 SV=1
12	Q9NK54	2.4	33.1	1711	0.025	0.006	CHIF_DROME Protein chiffon OS=Drosophila melanogaster OX=7227 GN=chif PE=1 SV=2
13	Q7TT50	3.3	32.7	1713	0.036	0.009	MRCKB_MOUSE Serine/threonine-protein kinase MRCK beta OS=Mus musculus OX=10090 GN=Cdc42bpb PE=1 SV=2
14	Q9Y5S2	4.4	32.3	1711	0.045	0.012	MRCKB_HUMAN Serine/threonine-protein kinase MRCK beta OS=Homo sapiens OX=9606 GN=CDC42BPB PE=1 SV=2
15	Q9NQT8	4.6	32.3	1826	0.067	0.016	KI13B_HUMAN Kinesin-like protein KIF13B OS=Homo sapiens OX=9606 GN=KIF13B PE=1 SV=2
16	Q0P5W1	6.8	32.0	1427	0.038	0.012	VPS8_MOUSE Vacuolar protein sorting-associated protein 8 homolog OS=Mus musculus OX=10090 GN=Vps8 PE=1 SV=1
17	O54728	7.0	31.6	1450	0.033	0.010	PLB1_RAT Phospholipase B1, membrane-associated OS=Rattus norvegicus OX=10116 GN=Plb1 PE=1 SV=1
18	G5EBN5	9.0	31.6	1492	0.058	0.017	G5EBN5_CAEEL BRO1 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ego-2 PE=1 SV=1
19	H8ESG1	9.0	31.6	1494	0.058	0.017	H8ESG1_CAEEL BRO1 domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=ego-2 PE=1 SV=1
20	Q8BGT5	9.4	31.2	522	0.071	0.061	ALAT2_MOUSE Alanine aminotransferase 2 OS=Mus musculus OX=10090 GN=Gpt2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06237 DUF1011	1.1e-33	126.8	Protein of unknown function (DUF1011)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000399979

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000426638	0.808	Electron transfer flavoprotein-ubiquinone oxidoreductase, mitochondrial
2	9606.ENSP00000292180	0.721	FAD synthase
3	9606.ENSP00000354032	0.597	Seipin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0032217	1.000	riboflavin transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071705	0.995	nitrogen compound transport
GO:0071702	0.995	organic substance transport
GO:0051180	0.994	vitamin transport
GO:0044281	0.991	small molecule metabolic process
GO:0071704	0.987	organic substance metabolic process
GO:0044237	0.987	cellular metabolic process
GO:0006767	0.980	water-soluble vitamin metabolic process
GO:0015711	0.979	organic anion transport
GO:0006807	0.976	nitrogen compound metabolic process
GO:1901564	0.963	organonitrogen compound metabolic process
GO:0046483	0.860	heterocycle metabolic process
GO:1901360	0.858	organic cyclic compound metabolic process
GO:0034641	0.816	cellular nitrogen compound metabolic process
GO:0032218	0.495	riboflavin transport

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:35015	1.000	riboflavin(in) = riboflavin(out)

[back to server]