StarFunc result for job id Q9NWF9

User Input

>input (866 residues)
MEEGNNNEEVIHLNNFHCHRGQEWINLRDGPITISDSSDEERIPMLVTPAPQQHEEEDLD
DDVILTEDDSEDDYGEFLDLGPPGISEFTKPSGQTEREPKPGPSHNQAANDIVNPRSEQK
VIILEEGSLLYTESDPLETQNQSSEDSETELLSNLGESAALADDQAIEEDCWLDHPYFQS
LNQQPREITNQVVPQERQPEAELGRLLFQHEFPGPAFPRPEPQQGGISGPSSPQPAHPLG
EFEDQQLASDDEEPGPAFPMQESQEPNLENIWGQEAAEVDQELVELLVKETEARFPDVAN
GFIEEIIHFKNYYDLNVLCNFLLENPDYPKREDRIIINPSSSLLASQDETKLPKIDFFDY
SKLTPLDQRCFIQAADLLMADFKVLSSQDIKWALHELKGHYAITRKALSDAIKKWQELSP
ETSGKRKKRKQMNQYSYIDFKFEQGDIKIEKRMFFLENKRRHCRSYDRRALLPAVQQEQE
FYEQKIKEMAEHEDFLLALQMNEEQYQKDGQLIECRCCYGEFPFEELTQCADAHLFCKEC
LIRYAQEAVFGSGKLELSCMEGSCTCSFPTSELEKVLPQTILYKYYERKAEEEVAAAYAD
ELVRCPSCSFPALLDSDVKRFSCPNPHCRKETCRKCQGLWKEHNGLTCEELAEKDDIKYR
TSIEEKMTAARIRKCHKCGTGLIKSEGCNRMSCRCGAQMCYLCRVSINGYDHFCQHPRSP
GAPCQECSRCSLWTDPTEDDEKLIEEIQKEAEEEQKRKNGENTFKRIGPPLEKPVEKVQR
VEALPRPVPQNLPQPQMPPYAFAHPPFPLPPVRPVFNNFPLNMGPIPAPYVPPLPNVRVN
YDFGPIHMPLEHNLPMHFGPQPRHRF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NWF9	1.000	1.000	0.000	866	1.000	1.000	Q9NWF9.pdb.gz	RN216_HUMAN E3 ubiquitin-protein ligase RNF216 OS=Homo sapiens OX=9606 GN=RNF216 PE=1 SV=3
2	AFDB:E7F859	0.496	0.513	4.712E-72	834	0.458	0.476	E7F859.pdb.gz	E7F859_DANRE E3 ubiquitin-protein ligase RNF216 OS=Danio rerio OX=7955 GN=rnf216 PE=4 SV=1
3	PDB:5tteB	0.143	0.260	1.816E-9	442	0.055	0.109	5tteB.pdb.gz	Structural insights into the mechanism and E2 specificity of the RBR E3 ubiquitin ligase HHARI.
4	PDB:4kblA	0.124	0.243	3.068E-9	395	0.061	0.134	4kblA.pdb.gz	Structure of HHARI, a RING-IBR-RING Ubiquitin Ligase: Autoinhibition of an Ariadne-Family E3 and Insights into Ligation Mechanism.
5	PDB:7b5lH	0.161	0.298	3.873E-9	423	0.059	0.121	7b5lH.pdb.gz	Ubiquitin ligation to F-box protein targets by SCF-RBR E3-E3 super-assembly.
6	PDB:7od1A	0.142	0.263	3.873E-9	430	0.055	0.112	7od1A.pdb.gz	CUL5-ARIH2 E3-E3 ubiquitin ligase structure reveals cullin-specific NEDD8 activation.
7	PDB:4zynB	0.118	0.237	4.600E-7	385	0.052	0.117	4zynB.pdb.gz	A Ubl/ubiquitin switch in the activation of Parkin.
8	PDB:7oniH	0.129	0.273	1.040E-6	380	0.042	0.095	7oniH.pdb.gz	CUL5-ARIH2 E3-E3 ubiquitin ligase structure reveals cullin-specific NEDD8 activation.
9	AFDB:Q8AXF4	0.075	0.094	1.337E-2	651	0.112	0.149	Q8AXF4.pdb.gz	FBX43_XENLA F-box only protein 43 OS=Xenopus laevis OX=8355 GN=fbxo43 PE=1 SV=1
10	AFDB:Q9VI93	0.057	0.056	1.688E-2	946	0.136	0.125	Q9VI93.pdb.gz	RN_DROME Zinc finger protein rotund OS=Drosophila melanogaster OX=7227 GN=rn PE=1 SV=2
11	AFDB:Q8K1M4	0.056	0.060	8.627E-2	789	0.142	0.156	Q8K1M4.pdb.gz	GLIS1_MOUSE Zinc finger protein GLIS1 OS=Mus musculus OX=10090 GN=Glis1 PE=1 SV=2
12	AFDB:Q6FN53	0.075	0.072	1.027E-1	915	0.088	0.083	Q6FN53.pdb.gz	STE20_CANGA Serine/threonine-protein kinase STE20 OS=Candida glabrata (strain ATCC 2001 / BCRC 20586 / JCM 3761 / NBRC 0622 / NRRL Y-65 / CBS 138) OX=284593 GN=STE20 PE=3 SV=1
13	AFDB:Q9WV66	0.076	0.093	2.610E-1	693	0.082	0.102	Q9WV66.pdb.gz	MARH7_MOUSE E3 ubiquitin-protein ligase MARCHF7 OS=Mus musculus OX=10090 GN=Marchf7 PE=2 SV=1
14	AFDB:Q8IRB5	0.047	0.033	3.295E-1	1465	0.142	0.084	Q8IRB5.pdb.gz	CLSPN_DROME Claspin OS=Drosophila melanogaster OX=7227 GN=Claspin PE=1 SV=1
15	PDB:1oqyA	0.086	0.167	3.410E-1	363	0.039	0.094	1oqyA.pdb.gz
16	PDB:7qcdC	0.055	0.160	3.410E-1	267	0.013	0.041	7qcdC.pdb.gz	Cryo-EM structure of the Smc5/6 holo-complex.
17	PDB:8a3tU	0.071	0.400	3.615E-1	114	0.020	0.149	8a3tU.pdb.gz	Cryo-EM structure of the S. cerevisiae APC/C-Cdh1 complex
18	AFDB:P34333	0.061	0.036	3.702E-1	1778	0.148	0.072	P34333.pdb.gz	NCOR1_CAEEL Nuclear receptor corepressor 1 OS=Caenorhabditis elegans OX=6239 GN=gei-8 PE=1 SV=4
19	AFDB:P51179	0.054	0.069	3.702E-1	628	0.067	0.092	P51179.pdb.gz	NR4A3_RAT Nuclear receptor subfamily 4 group A member 3 OS=Rattus norvegicus OX=10116 GN=Nr4a3 PE=1 SV=1
20	PDB:5apnp	0.042	0.202	1.644	91	0.012	0.110	5apnp.pdb.gz	Insertion of the Biogenesis Factor Rei1 Probes the Ribosomal Tunnel during 60S Maturation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D3ZU60	0.0	1397	910	0.851	0.810	D3ZU60_RAT Ring finger protein 216 OS=Rattus norvegicus OX=10116 GN=Rnf216 PE=4 SV=2
2	E7F859	0.0	694	834	0.473	0.492	E7F859_DANRE E3 ubiquitin-protein ligase RNF216 OS=Danio rerio OX=7955 GN=rnf216 PE=4 SV=1
3	Q9NWF9	0.0	1787	866	1.000	1.000	RN216_HUMAN E3 ubiquitin-protein ligase RNF216 OS=Homo sapiens OX=9606 GN=RNF216 PE=1 SV=3
4	A9JTG5	4.69e-10	65.9	714	0.074	0.090	HOIL1_DANRE RanBP-type and C3HC4-type zinc finger-containing protein 1 OS=Danio rerio OX=7955 GN=rbck1 PE=2 SV=1
5	H7C3G0	2.18e-09	61.6	264	0.066	0.216	H7C3G0_HUMAN RBR-type E3 ubiquitin transferase (Fragment) OS=Homo sapiens OX=9606 GN=RNF144A PE=1 SV=1
6	P50876	2.32e-09	62.0	292	0.066	0.195	R144A_HUMAN E3 ubiquitin-protein ligase RNF144A OS=Homo sapiens OX=9606 GN=RNF144A PE=1 SV=2
7	F1RB95	7.73e-09	61.2	459	0.090	0.170	RNF14_DANRE E3 ubiquitin-protein ligase RNF14 OS=Danio rerio OX=7955 GN=rnf14 PE=2 SV=1
8	Q8TC41	2.76e-08	59.7	542	0.067	0.107	RN217_HUMAN E3 ubiquitin-protein ligase RNF217 OS=Homo sapiens OX=9606 GN=RNF217 PE=1 SV=4
9	Q20871	4.00e-08	58.9	437	0.066	0.130	Q20871_CAEEL RBR-type E3 ubiquitin transferase OS=Caenorhabditis elegans OX=6239 GN=CELE_F56D2.5 PE=1 SV=2
10	Q6GMF9	4.15e-08	59.3	515	0.065	0.109	Q6GMF9_DANRE RanBP-type and C3HC4-type zinc finger-containing protein 1 OS=Danio rerio OX=7955 GN=zgc:91964 PE=2 SV=1
11	Q9BYM8	4.83e-06	52.4	510	0.068	0.116	HOIL1_HUMAN RanBP-type and C3HC4-type zinc finger-containing protein 1 OS=Homo sapiens OX=9606 GN=RBCK1 PE=1 SV=2
12	Q62921	6.74e-06	52.0	508	0.068	0.116	HOIL1_RAT RanBP-type and C3HC4-type zinc finger-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Rbck1 PE=1 SV=3
13	Q9WUB0	8.43e-06	51.6	508	0.065	0.110	HOIL1_MOUSE RanBP-type and C3HC4-type zinc finger-containing protein 1 OS=Mus musculus OX=10090 GN=Rbck1 PE=1 SV=2
14	Q9SJT6	2.65e-05	50.1	468	0.053	0.098	Q9SJT6_ARATH IBR domain containing protein OS=Arabidopsis thaliana OX=3702 GN=RFA4 PE=4 SV=1
15	O95376	4.37e-05	49.3	493	0.053	0.093	ARI2_HUMAN E3 ubiquitin-protein ligase ARIH2 OS=Homo sapiens OX=9606 GN=ARIH2 PE=1 SV=1
16	Q6IBL8	4.37e-05	49.3	493	0.053	0.093	Q6IBL8_HUMAN RBR-type E3 ubiquitin transferase OS=Homo sapiens OX=9606 GN=ARIH2 PE=2 SV=1
17	Q9NV58	7.13e-05	48.9	838	0.073	0.075	RN19A_HUMAN E3 ubiquitin-protein ligase RNF19A OS=Homo sapiens OX=9606 GN=RNF19A PE=1 SV=3
18	Q9Z1K6	7.64e-05	48.5	492	0.053	0.093	ARI2_MOUSE E3 ubiquitin-protein ligase ARIH2 OS=Mus musculus OX=10090 GN=Arih2 PE=1 SV=1
19	Q9Z1K5	9.69e-05	48.5	555	0.061	0.095	ARI1_MOUSE E3 ubiquitin-protein ligase ARIH1 OS=Mus musculus OX=10090 GN=Arih1 PE=1 SV=3
20	P50636	1.01e-04	48.5	840	0.073	0.075	RN19A_MOUSE E3 ubiquitin-protein ligase RNF19A OS=Mus musculus OX=10090 GN=Rnf19a PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09504 RE_Bsp6I	1.7e+02	13.3	Bsp6I restriction endonuclease

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9601.ENSPPYP00000019429

Rank	PPI partner	STRING score	Description
1	9601.ENSPPYP00000018190	0.815	Ring finger protein 144B
2	9601.ENSPPYP00000024036	0.813	Ankyrin repeat and IBR domain containing 1
3	9601.ENSPPYP00000001823	0.809	Ring finger protein 19B
4	9601.ENSPPYP00000008294	0.777	Deubiquitinase that specifically cleaves 'Lys-63'- and linear 'Met-1'-linked polyubiquitin chains and is involved in NF-kappa-B activation and TNF-alpha-induced necroptosis. Plays an important role in the regulation of pathways leading to NF-kappa-B activation. Contributes to the regulation of cell survival, proliferation and differentiation via its effects on NF-kappa-B activation. Negative regulator of Wnt signaling. Inhibits HDAC6 and thereby promotes acetylation of alpha-tubulin and stabilization of microtubules. Plays a role in the regulation of microtubule dynamics, and thereby c [...]
5	9601.ENSPPYP00000017150	0.763	OTU deubiquitinase with linear linkage specificity
6	9601.ENSPPYP00000023381	0.748	Inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase gamma
7	9601.ENSPPYP00000019018	0.735	Ring finger protein 217
8	9601.ENSPPYP00000007003	0.680	Belongs to the TNF receptor-associated factor family.
9	9601.ENSPPYP00000018096	0.680	Receptor (TNFRSF)-interacting serine-threonine kinase 1
10	9601.ENSPPYP00000014319	0.669	Pongo abelii Rho GTPase activating protein 15 (ARHGAP15), mRNA
11	9601.ENSPPYP00000004766	0.661	Tumor necrosis factor receptor superfamily, member 1A
12	9601.ENSPPYP00000007505	0.624	Ariadne RBR E3 ubiquitin protein ligase 1
13	9601.ENSPPYP00000002731	0.620	Mitochondrial calcium uptake 1
14	9601.ENSPPYP00000005983	0.618	Ubiquitin conjugating enzyme E2 L5, pseudogene
15	9601.ENSPPYP00000012943	0.618	Ubiquitin-conjugating enzyme E2 that specifically acts with HECT-type and RBR family E3 ubiquitin-protein ligases. Does not function with most RING-containing E3 ubiquitin-protein ligases because it lacks intrinsic E3-independent reactivity with lysine: in contrast, it has activity with the RBR family E3 enzymes, such as PRKN and ARIH1, that function like function like RING-HECT hybrids. Accepts ubiquitin from the E1 complex and catalyzes its covalent attachment to other proteins. In vitro catalyzes 'Lys-11'-linked polyubiquitination. Involved in the selective degradation of short-live [...]
16	9601.ENSPPYP00000023103	0.615	ALG13, UDP-N-acetylglucosaminyltransferase subunit
17	9601.ENSPPYP00000014147	0.584	Ring finger protein 144A
18	9601.ENSPPYP00000020804	0.569	Inhibitor of kappa light polypeptide gene enhancer in B-cells, kinase beta
19	9601.ENSPPYP00000012072	0.564	Mitochondrial antiviral signaling protein
20	9601.ENSPPYP00000009157	0.559	Ring finger protein 135

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0061630	1.000	ubiquitin protein ligase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.995	regulation of biological process
GO:0071704	0.994	organic substance metabolic process
GO:0044238	0.994	primary metabolic process
GO:0006807	0.988	nitrogen compound metabolic process
GO:0019538	0.980	protein metabolic process
GO:0030163	0.946	protein catabolic process
GO:0009987	0.942	cellular process
GO:0050794	0.913	regulation of cellular process
GO:0048583	0.882	regulation of response to stimulus
GO:0060255	0.868	regulation of macromolecule metabolic process
GO:0036211	0.867	protein modification process
GO:0032446	0.811	protein modification by small protein conjugation
GO:0016567	0.776	protein ubiquitination
GO:0044237	0.744	cellular metabolic process
GO:0010468	0.731	regulation of gene expression
GO:0080134	0.712	regulation of response to stress
GO:0048519	0.681	negative regulation of biological process
GO:0051603	0.678	proteolysis involved in protein catabolic process
GO:0032101	0.666	regulation of response to external stimulus
GO:0002831	0.625	regulation of response to biotic stimulus
GO:0031347	0.607	regulation of defense response
GO:0001817	0.548	regulation of cytokine production
GO:0044248	0.537	cellular catabolic process
GO:0006511	0.478	ubiquitin-dependent protein catabolic process
GO:0000209	0.455	protein polyubiquitination
GO:0050896	0.359	response to stimulus
GO:0048518	0.355	positive regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.998	cytoplasm
GO:0005634	0.996	nucleus
GO:0005829	0.994	cytosol
GO:0005654	0.993	nucleoplasm
GO:0030054	0.372	cell junction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	1.000	Transferases.

[back to server]