StarFunc result for job id Q9NWQ8

User Input

>input (432 residues)
MGPAGSLLGSGQMQITLWGSLAAVAIFFVITFLIFLCSSCDREKKPRQHSGDHENLMNVP
SDKEMFSRSVTSLATDAPASSEQNGALTNGDILSEDSTLTCMQHYEEVQTSASDLLDSQD
STGKPKCHQSRELPRIPPESAVDTMLTARSVDGDQGLGMEGPYEVLKDSSSQENMVEDCL
YETVKEIKEVAAAAHLEKGHSGKAKSTSASKELPGPQTEGKAEFAEYASVDRNKKCRQSV
NVESILGNSCDPEEEAPPPVPVKLLDENENLQEKEGGEAEESATDTTSETNKRFSSLSYK
SREEDPTLTEEEISAMYSSVNKPGQLVNKSGQSLTVPESTYTSIQGDPQRSPSSCNDLYA
TVKDFEKTPNSTLPPAGRPSEEPEPDYEAIQTLNREEEKATLGTNGHHGLVPKENDYESI
SDLQQGRDITRL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NWQ8	0.999	0.999	1.084E-58	432	1.000	1.000	Q9NWQ8.pdb.gz	PHAG1_HUMAN Phosphoprotein associated with glycosphingolipid-enriched microdomains 1 OS=Homo sapiens OX=9606 GN=PAG1 PE=1 SV=2
2	AFDB:Q8BHB3	0.086	0.090	1.587E-1	407	0.139	0.147	Q8BHB3.pdb.gz	LAX1_MOUSE Lymphocyte transmembrane adapter 1 OS=Mus musculus OX=10090 GN=Lax1 PE=2 SV=2
3	AFDB:Q3HKQ0	0.072	0.075	2.370E-1	415	0.169	0.176	Q3HKQ0.pdb.gz	Q3HKQ0_DROME BG642163, isoform A OS=Drosophila melanogaster OX=7227 GN=BG642163 PE=1 SV=1
4	AFDB:Q0GGX2	0.051	0.025	2.709E-1	1363	0.192	0.061	Q0GGX2.pdb.gz	ZN541_MOUSE Zinc finger protein 541 OS=Mus musculus OX=10090 GN=Znf541 PE=1 SV=1
5	AFDB:Q9Y6Q6	0.069	0.051	3.784E-1	616	0.167	0.117	Q9Y6Q6.pdb.gz	TNR11_HUMAN Tumor necrosis factor receptor superfamily member 11A OS=Homo sapiens OX=9606 GN=TNFRSF11A PE=1 SV=1
6	AFDB:Q8BW22	0.089	0.095	4.325E-1	402	0.146	0.157	Q8BW22.pdb.gz	CREST_MOUSE Calcium-responsive transactivator OS=Mus musculus OX=10090 GN=Ss18l1 PE=1 SV=1
7	AFDB:Q8IWV1	0.088	0.095	4.624E-1	398	0.137	0.148	Q8IWV1.pdb.gz	LAX1_HUMAN Lymphocyte transmembrane adapter 1 OS=Homo sapiens OX=9606 GN=LAX1 PE=1 SV=1
8	AFDB:A0A0A6YWY8	0.095	0.040	6.042E-1	1203	0.141	0.051	A0A0A6YWY8.pdb.gz	A0A0A6YWY8_MOUSE Protocadherin 9 OS=Mus musculus OX=10090 GN=Pcdh9 PE=1 SV=1
9	AFDB:B2RY69	0.107	0.045	7.384E-1	1237	0.150	0.053	B2RY69.pdb.gz	B2RY69_MOUSE Protocadherin 9 OS=Mus musculus OX=10090 GN=Pcdh9 PE=2 SV=1
10	AFDB:Q52KP9	0.103	0.069	7.384E-1	679	0.155	0.099	Q52KP9.pdb.gz	Q52KP9_MOUSE Kidins220 protein (Fragment) OS=Mus musculus OX=10090 GN=Kidins220 PE=2 SV=1
11	PDB:6fvtN	0.067	0.036	7.759	922	0.023	0.011	6fvtN.pdb.gz	Expanded Coverage of the 26S Proteasome Conformational Landscape Reveals Mechanisms of Peptidase Gating.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q3U1F9	0.0	671	429	0.789	0.795	PHAG1_MOUSE Phosphoprotein associated with glycosphingolipid-enriched microdomains 1 OS=Mus musculus OX=10090 GN=Pag1 PE=1 SV=2
2	Q9JM80	0.0	669	424	0.799	0.814	PHAG1_RAT Phosphoprotein associated with glycosphingolipid-enriched microdomains 1 OS=Rattus norvegicus OX=10116 GN=Pag1 PE=1 SV=1
3	Q9NWQ8	0.0	888	432	1.000	1.000	PHAG1_HUMAN Phosphoprotein associated with glycosphingolipid-enriched microdomains 1 OS=Homo sapiens OX=9606 GN=PAG1 PE=1 SV=2
4	A0A2R8QPJ6	0.81	34.7	1902	0.042	0.009	A0A2R8QPJ6_DANRE Plexin-A2 OS=Danio rerio OX=7955 GN=plxna2 PE=1 SV=1
5	Q9UIW2	1.7	33.5	1896	0.042	0.009	PLXA1_HUMAN Plexin-A1 OS=Homo sapiens OX=9606 GN=PLXNA1 PE=1 SV=3
6	D7SFQ5	1.8	33.1	458	0.113	0.107	D7SFQ5_CAEEL J domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=dnj-25 PE=1 SV=1
7	D7SFQ6	1.8	33.1	441	0.113	0.111	D7SFQ6_CAEEL J domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=dnj-25 PE=1 SV=1
8	O60934	3.9	32.3	754	0.044	0.025	NBN_HUMAN Nibrin OS=Homo sapiens OX=9606 GN=NBN PE=1 SV=1
9	A0A0A0MTN9	5.3	32.0	439	0.072	0.071	A0A0A0MTN9_HUMAN NADPH:adrenodoxin oxidoreductase, mitochondrial OS=Homo sapiens OX=9606 GN=FDXR PE=1 SV=1
10	H3BVI2	5.3	31.2	230	0.072	0.135	H3BVI2_HUMAN Sp1 transcription factor (Fragment) OS=Homo sapiens OX=9606 GN=SP1 PE=1 SV=1
11	Q5XWE1	5.3	30.4	131	0.039	0.130	PROF_CITLA Profilin OS=Citrullus lanatus OX=3654 PE=1 SV=1
12	G5EDJ6	5.5	32.0	784	0.113	0.062	G5EDJ6_CAEEL Auxilin OS=Caenorhabditis elegans OX=6239 GN=dnj-25 PE=1 SV=1
13	A0A0A0MSZ4	5.7	31.6	522	0.072	0.059	A0A0A0MSZ4_HUMAN NADPH:adrenodoxin oxidoreductase, mitochondrial OS=Homo sapiens OX=9606 GN=FDXR PE=1 SV=1
14	A0A0C4DGN7	6.2	31.6	497	0.072	0.062	A0A0C4DGN7_HUMAN NADPH:adrenodoxin oxidoreductase, mitochondrial OS=Homo sapiens OX=9606 GN=FDXR PE=1 SV=1
15	P09436	6.2	32.0	1072	0.049	0.020	SYIC_YEAST Isoleucine--tRNA ligase, cytoplasmic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ILS1 PE=1 SV=1
16	A0A0A0MTR6	6.4	31.6	483	0.072	0.064	A0A0A0MTR6_HUMAN NADPH:adrenodoxin oxidoreductase, mitochondrial OS=Homo sapiens OX=9606 GN=FDXR PE=1 SV=1
17	P22570	6.5	31.6	491	0.072	0.063	ADRO_HUMAN NADPH:adrenodoxin oxidoreductase, mitochondrial OS=Homo sapiens OX=9606 GN=FDXR PE=1 SV=3
18	P70206	6.5	32.0	1894	0.044	0.010	PLXA1_MOUSE Plexin-A1 OS=Mus musculus OX=10090 GN=Plxna1 PE=1 SV=1
19	A0A0C4DFN8	6.7	31.6	491	0.072	0.063	A0A0C4DFN8_HUMAN NADPH:adrenodoxin oxidoreductase, mitochondrial OS=Homo sapiens OX=9606 GN=FDXR PE=1 SV=1
20	J3QQX3	7.0	31.6	463	0.072	0.067	J3QQX3_HUMAN NADPH:adrenodoxin oxidoreductase, mitochondrial OS=Homo sapiens OX=9606 GN=FDXR PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16492 Cadherin_C_2	29	16.7	Cadherin cytoplasmic C-terminal
2	PF15347 PAG	1.4e-221	747.7	Phosphoprotein associated with glycosphingolipid-enriched

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000220597

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000220003	0.999	Tyrosine-protein kinase CSK
2	9606.ENSP00000428924	0.996	Tyrosine-protein kinase Lyn
3	9606.ENSP00000346671	0.988	Tyrosine-protein kinase Fyn
4	9606.ENSP00000337825	0.983	Tyrosine-protein kinase Lck
5	9606.ENSP00000362680	0.980	Proto-oncogene tyrosine-protein kinase Src
6	9606.ENSP00000264972	0.958	Tyrosine-protein kinase ZAP-70
7	9606.ENSP00000356042	0.956	Ezrin
8	9606.ENSP00000376345	0.947	Growth factor receptor-bound protein 2
9	9606.ENSP00000340944	0.945	Tyrosine-protein phosphatase non-receptor type 11
10	9606.ENSP00000275493	0.931	Epidermal growth factor receptor
11	9606.ENSP00000011653	0.928	T-cell surface glycoprotein CD4
12	9606.ENSP00000354782	0.923	T-cell surface glycoprotein CD3 zeta chain
13	9606.ENSP00000354566	0.916	T-cell surface glycoprotein CD3 epsilon chain
14	9606.ENSP00000262995	0.914	GRB2-associated-binding protein 1
15	9606.ENSP00000331172	0.914	T-cell surface glycoprotein CD8 beta chain
16	9606.ENSP00000431445	0.914	T-cell surface glycoprotein CD3 gamma chain
17	9606.ENSP00000386559	0.909	T-cell surface glycoprotein CD8 alpha chain
18	9606.ENSP00000221972	0.907	B-cell antigen receptor complex-associated protein alpha chain
19	9606.ENSP00000300692	0.907	T-cell surface glycoprotein CD3 delta chain
20	9606.ENSP00000378786	0.907	HLA class II histocompatibility antigen, DR alpha chain

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0019904	0.978	protein domain specific binding
GO:0042169	0.971	SH2 domain binding
GO:0005102	0.463	signaling receptor binding
GO:0019899	0.366	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.999	regulation of cellular process
GO:0051716	0.997	cellular response to stimulus
GO:0007165	0.994	signal transduction
GO:0050863	0.969	regulation of T cell activation
GO:0035556	0.906	intracellular signal transduction
GO:0048519	0.558	negative regulation of biological process
GO:0048523	0.539	negative regulation of cellular process
GO:0030155	0.519	regulation of cell adhesion
GO:0022407	0.398	regulation of cell-cell adhesion
GO:1903037	0.387	regulation of leukocyte cell-cell adhesion
GO:0048518	0.356	positive regulation of biological process
GO:0007166	0.334	cell surface receptor signaling pathway
GO:0048583	0.332	regulation of response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.999	plasma membrane
GO:0045121	0.994	membrane raft
GO:0012505	0.481	endomembrane system
GO:0005622	0.413	intracellular anatomical structure
GO:0043231	0.398	intracellular membrane-bounded organelle
GO:0005737	0.363	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]