StarFunc result for job id Q9NWQ9

User Input

>input (140 residues)
MPLESSSSMPLSFPSLLPSVPHNTNPSPPLMSYITSQEMKCILHWFANWSGPQRERFLED
LVAKAVPEKLQPLLDSLEQLSVSGADRPPSIFECQLHLWDQWFRGWAEQERNEFVRQLEF
SEPDFVAKFYQAVAATAGKD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NWQ9	1.000	1.000	3.045E-22	140	1.000	1.000	Q9NWQ9.pdb.gz	CN119_HUMAN Uncharacterized protein C14orf119 OS=Homo sapiens OX=9606 GN=C14orf119 PE=1 SV=1
2	AFDB:Q3UZP0	0.167	0.062	7.367E-1	555	0.129	0.032	Q3UZP0.pdb.gz	MALD2_MOUSE MARVEL domain-containing protein 2 OS=Mus musculus OX=10090 GN=Marveld2 PE=1 SV=1
3	AFDB:P55199	0.156	0.057	8.340E-1	621	0.150	0.034	P55199.pdb.gz	ELL_HUMAN RNA polymerase II elongation factor ELL OS=Homo sapiens OX=9606 GN=ELL PE=1 SV=1
4	AFDB:A0A0B4KFS5	0.186	0.043	1.004	991	0.136	0.019	A0A0B4KFS5.pdb.gz	A0A0B4KFS5_DROME Aspartyl beta-hydroxylase, isoform L OS=Drosophila melanogaster OX=7227 GN=Asph PE=1 SV=1
5	AFDB:O32348	0.164	0.161	1.370	144	0.136	0.132	O32348.pdb.gz	FLIX_CAUVC Flagellar assembly protein FliX OS=Caulobacter vibrioides (strain ATCC 19089 / CB15) OX=190650 GN=fliX PE=1 SV=1
6	PDB:7yxxA	0.217	0.034	1.489	1754	0.150	0.012	7yxxA.pdb.gz
7	PDB:7pubFh	0.153	0.099	1.793	274	0.114	0.058	7pubFh.pdb.gz	Mitoribosomal small subunit maturation involves formation of initiation-like complexes.
8	AFDB:Q9BTX7	0.120	0.058	1.868	342	0.107	0.044	Q9BTX7.pdb.gz	TTPAL_HUMAN Alpha-tocopherol transfer protein-like OS=Homo sapiens OX=9606 GN=TTPAL PE=1 SV=2
9	PDB:3hybA	0.249	0.287	1.908	115	0.143	0.174	3hybA.pdb.gz
10	PDB:6ki0A	0.289	0.095	1.908	459	0.079	0.024	6ki0A.pdb.gz	Homotypic CARD-CARD interaction is critical for the activation of NLRP1 inflammasome.
11	AFDB:A0A0S2Z5U7	0.162	0.104	1.987	239	0.150	0.088	A0A0S2Z5U7.pdb.gz	A0A0S2Z5U7_HUMAN Direct IAP-binding protein with low pI (Fragment) OS=Homo sapiens OX=9606 GN=DIABLO PE=2 SV=1
12	AFDB:O08856	0.177	0.060	2.249	602	0.136	0.032	O08856.pdb.gz	ELL_MOUSE RNA polymerase II elongation factor ELL OS=Mus musculus OX=10090 GN=Ell PE=2 SV=2
13	AFDB:Q9ZT92	0.206	0.077	2.393	569	0.114	0.028	Q9ZT92.pdb.gz	AK10B_ARATH RNA demethylase ALKBH10B OS=Arabidopsis thaliana OX=3702 GN=ALKBH10B PE=1 SV=1
14	PDB:4jrbA	0.193	0.084	2.767	398	0.136	0.048	4jrbA.pdb.gz
15	AFDB:Q9T031	0.143	0.063	2.883	375	0.100	0.037	Q9T031.pdb.gz	FBK96_ARATH F-box/kelch-repeat protein At4g39240 OS=Arabidopsis thaliana OX=3702 GN=At4g39240 PE=2 SV=1
16	PDB:3vv9B	0.147	0.097	3.546	268	0.129	0.067	3vv9B.pdb.gz	Structure of the trypanosome cyanide-insensitive alternative oxidase
17	PDB:3hf4A	0.176	0.175	4.015	141	0.129	0.128	3hf4A.pdb.gz	Quaternary structural variability in rat hemoglobin
18	PDB:7c79B	0.196	0.049	4.015	793	0.143	0.025	7c79B.pdb.gz	Structural insight into precursor ribosomal RNA processing by ribonuclease MRP.
19	PDB:7t55A	0.152	0.043	4.545	715	0.121	0.024	7t55A.pdb.gz	Structures of the peptidase-containing ABC transporter PCAT1 under equilibrium and nonequilibrium conditions.
20	PDB:7vvuV	0.183	0.213	4.545	113	0.093	0.115	7vvuV.pdb.gz	Structure of the NuA4 acetyltransferase complex bound to the nucleosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9NWQ9	5.82e-101	286	140	1.000	1.000	CN119_HUMAN Uncharacterized protein C14orf119 OS=Homo sapiens OX=9606 GN=C14orf119 PE=1 SV=1
2	Q54TL0	0.016	36.6	1255	0.157	0.018	KIF7_DICDI Kinesin-related protein 7 OS=Dictyostelium discoideum OX=44689 GN=kif7 PE=2 SV=1
3	P39538	1.1	31.2	1254	0.107	0.012	UBP12_YEAST Ubiquitin carboxyl-terminal hydrolase 12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=UBP12 PE=1 SV=1
4	Q9NWB6	1.8	30.4	273	0.107	0.055	ARGL1_HUMAN Arginine and glutamate-rich protein 1 OS=Homo sapiens OX=9606 GN=ARGLU1 PE=1 SV=1
5	P32893	2.9	30.0	560	0.136	0.034	TRS65_YEAST Trafficking protein particle complex II-specific subunit 65 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TRS65 PE=1 SV=1
6	Q9H479	3.0	30.0	309	0.100	0.045	FN3K_HUMAN Fructosamine-3-kinase OS=Homo sapiens OX=9606 GN=FN3K PE=1 SV=1
7	Q8GYL7	5.4	29.3	852	0.157	0.026	PP361_ARATH Pentatricopeptide repeat-containing protein At5g02830, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At5g02830 PE=2 SV=3
8	M9NCR4	7.0	28.9	15105	0.086	0.001	M9NCR4_DROME Dumpy, isoform J OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
9	M9NER8	7.0	28.9	15638	0.086	0.001	M9NER8_DROME Dumpy, isoform I OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
10	M9PCJ8	7.0	28.9	14825	0.086	0.001	M9PCJ8_DROME Dumpy, isoform X OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
11	Q96EV2	7.1	28.9	1170	0.200	0.024	RBM33_HUMAN RNA-binding protein 33 OS=Homo sapiens OX=9606 GN=RBM33 PE=1 SV=3
12	M9PB32	7.3	28.9	19560	0.086	0.001	M9PB32_DROME Dumpy, isoform AA OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
13	M9PBZ4	7.3	28.9	18014	0.086	0.001	M9PBZ4_DROME Dumpy, isoform W OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
14	Q8I640	7.5	28.9	2860	0.114	0.006	Q8I640_PLAF7 Erythrocyte membrane protein 1, PfEMP1 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1200400 PE=4 SV=1
15	P77247	7.8	28.5	222	0.093	0.059	HXPB_ECOLI Hexitol phosphatase B OS=Escherichia coli (strain K12) OX=83333 GN=hxpB PE=1 SV=1
16	X1WC30	8.0	28.9	878	0.086	0.014	X1WC30_DANRE Protein moonraker isoform X1 OS=Danio rerio OX=7955 GN=si:dkey-243i1.1 PE=4 SV=1
17	M9PEH5	9.1	28.9	20710	0.086	0.001	M9PEH5_DROME Dumpy, isoform P OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
18	M9PB30	9.4	28.5	22949	0.086	0.001	M9PB30_DROME Dumpy, isoform Q OS=Drosophila melanogaster OX=7227 GN=dpy PE=1 SV=1
19	M9PBZ0	9.4	28.5	22830	0.086	0.001	M9PBZ0_DROME Dumpy, isoform R OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
20	M9PC41	9.4	28.5	22743	0.086	0.001	M9PC41_DROME Dumpy, isoform O OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12125 Beta-TrCP_D	2.3e+02	13.3	D domain of beta-TrCP
2	PF14969 DUF4508	3e-31	118.9	Domain of unknown function (DUF4508)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000322238

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000299192	0.746	HEAT repeat-containing protein 3
2	9606.ENSP00000345659	0.721	Carbonic anhydrase 7
3	9606.ENSP00000340887	0.582	Uncharacterized protein C5orf47
4	9606.ENSP00000367312	0.564	Protein sel-1 homolog 2
5	9606.ENSP00000360129	0.562	EF-hand calcium-binding domain-containing protein 7
6	9606.ENSP00000403937	0.557	Uncharacterized protein C11orf74
7	9606.ENSP00000314099	0.536	Carbonic anhydrase 5B, mitochondrial
8	9606.ENSP00000355434	0.529	Olfactory receptor 2L13
9	9606.ENSP00000240651	0.528	Pyridine nucleotide-disulfide oxidoreductase domain-containing protein 1
10	9606.ENSP00000331577	0.527	Zinc finger protein 397
11	9606.ENSP00000298622	0.506	Janus kinase and microtubule interacting protein 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.455	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.988	cellular process
GO:0065007	0.889	biological regulation
GO:0050789	0.872	regulation of biological process
GO:0050794	0.760	regulation of cellular process
GO:0008152	0.511	metabolic process
GO:0019222	0.435	regulation of metabolic process
GO:0051171	0.399	regulation of nitrogen compound metabolic process
GO:0060255	0.382	regulation of macromolecule metabolic process
GO:0080090	0.368	regulation of primary metabolic process
GO:0044237	0.339	cellular metabolic process
GO:0071704	0.310	organic substance metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005739	0.998	mitochondrion
GO:0005634	0.721	nucleus
GO:0070013	0.708	intracellular organelle lumen
GO:0031981	0.702	nuclear lumen
GO:0005654	0.484	nucleoplasm
GO:0012505	0.330	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]