StarFunc result for job id Q9NWR8

User Input

>input (336 residues)
MLQRGLWPWRTRLLPTPGTWRPARPWPLPPPPQVLRVKLCGNVKYYQSHHYSTVVPPDEI
TVIYRHGLPLVTLTLPSRKERCQFVVKPMLSTVGSFLQDLQNEDKGIKTAAIFTADGNMI
SASTLMDILLMNDFKLVINKIAYDVQCPKREKPSNEHTAEMEHMKSLVHRLFTILHLEES
QKKREHHLLEKIDHLKEQLQPLEQVKAGIEAHSEAKTSGLLWAGLALLSIQGGALAWLTW
WVYSWDIMEPVTYFITFANSMVFFAYFIVTRQDYTYSAVKSRQFLQFFHKKSKQQHFDVQ
QYNKLKEDLAKAKESLKQARHSLCLQMQVEELNEKN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q9NWR8	1.000	1.000	3.140E-55	336	1.000	1.000	Q9NWR8.pdb.gz	MCUB_HUMAN Calcium uniporter regulatory subunit MCUb, mitochondrial OS=Homo sapiens OX=9606 GN=MCUB PE=1 SV=2
2	AFDB:Q810S1	0.778	0.759	2.131E-41	345	0.735	0.716	Q810S1.pdb.gz	MCUB_MOUSE Calcium uniporter regulatory subunit MCUb, mitochondrial OS=Mus musculus OX=10090 GN=Mcub PE=1 SV=1
3	AFDB:Q08BI9	0.652	0.591	5.684E-30	376	0.411	0.367	Q08BI9.pdb.gz	MCU_DANRE Calcium uniporter protein, mitochondrial OS=Danio rerio OX=7955 GN=mcu PE=1 SV=1
4	AFDB:Q8NE86	0.621	0.597	7.585E-30	351	0.429	0.410	Q8NE86.pdb.gz	MCU_HUMAN Calcium uniporter protein, mitochondrial OS=Homo sapiens OX=9606 GN=MCU PE=1 SV=1
5	AFDB:Q8IQ70	0.408	0.378	2.905E-26	366	0.330	0.303	Q8IQ70.pdb.gz	MCU_DROME Calcium uniporter protein, mitochondrial OS=Drosophila melanogaster OX=7227 GN=MCU PE=1 SV=2
6	PDB:6o58A	0.524	0.631	3.386E-24	273	0.390	0.480	6o58A.pdb.gz
7	AFDB:Q21121	0.430	0.434	9.862E-24	333	0.307	0.309	Q21121.pdb.gz	MCU_CAEEL Calcium uniporter protein, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=mcu-1 PE=1 SV=2
8	AFDB:E9DVV4	0.375	0.269	2.831E-9	484	0.182	0.126	E9DVV4.pdb.gz	E9DVV4_METAQ Calcium uniporter protein OS=Metarhizium acridum (strain CQMa 102) OX=655827 GN=MAC_01752 PE=1 SV=1
9	AFDB:Q7S4I4	0.338	0.242	1.901E-8	493	0.188	0.128	Q7S4I4.pdb.gz	Q7S4I4_NEUCR Calcium uniporter protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=NCU08166 PE=1 SV=1
10	PDB:6dt0A	0.265	0.349	5.208E-8	236	0.140	0.199	6dt0A.pdb.gz
11	AFDB:W2SDE2	0.369	0.360	1.204E-7	346	0.131	0.127	W2SDE2.pdb.gz	W2SDE2_9EURO Calcium uniporter protein OS=Cyphellophora europaea CBS 101466 OX=1220924 GN=HMPREF1541_00236 PE=1 SV=1
12	AFDB:Q54LT0	0.410	0.491	3.211E-7	275	0.149	0.182	Q54LT0.pdb.gz	MCU_DICDI Calcium uniporter protein, mitochondrial OS=Dictyostelium discoideum OX=44689 GN=DDB0186972 PE=1 SV=1
13	PDB:6dnfA	0.285	0.399	5.235E-7	225	0.113	0.169	6dnfA.pdb.gz
14	PDB:5ia8A	0.157	0.458	1.346E-2	92	0.048	0.174	5ia8A.pdb.gz
15	PDB:7np7D4	0.129	0.111	5.074E-2	415	0.068	0.055	7np7D4.pdb.gz
16	PDB:3h9dA	0.129	0.332	5.375E-2	116	0.051	0.147	3h9dA.pdb.gz	Trypanosoma brucei ATG8: structural insights into autophagic-like mechanisms in protozoa.
17	PDB:1wz0A	0.136	0.369	6.771E-2	104	0.039	0.125	1wz0A.pdb.gz
18	PDB:6yvaC	0.139	0.269	9.571E-2	155	0.018	0.039	6yvaC.pdb.gz
19	PDB:7np7D1	0.138	0.104	1.277E-1	485	0.071	0.049	7np7D1.pdb.gz
20	PDB:1j0gA	0.159	0.460	1.433E-1	92	0.054	0.196	1j0gA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q9NWR8	0.0	701	336	1.000	1.000	MCUB_HUMAN Calcium uniporter regulatory subunit MCUb, mitochondrial OS=Homo sapiens OX=9606 GN=MCUB PE=1 SV=2
2	Q810S1	2.69e-171	481	345	0.735	0.716	MCUB_MOUSE Calcium uniporter regulatory subunit MCUb, mitochondrial OS=Mus musculus OX=10090 GN=Mcub PE=1 SV=1
3	Q8NE86	5.06e-98	295	351	0.414	0.396	MCU_HUMAN Calcium uniporter protein, mitochondrial OS=Homo sapiens OX=9606 GN=MCU PE=1 SV=1
4	Q3UMR5	6.23e-97	292	350	0.411	0.394	MCU_MOUSE Calcium uniporter protein, mitochondrial OS=Mus musculus OX=10090 GN=Mcu PE=1 SV=2
5	A0A8I6A2V9	7.37e-97	291	310	0.405	0.439	A0A8I6A2V9_RAT Calcium uniporter protein OS=Rattus norvegicus OX=10116 GN=Mcu PE=1 SV=1
6	M0RDI5	1.21e-96	291	323	0.405	0.421	M0RDI5_RAT Calcium uniporter protein OS=Rattus norvegicus OX=10116 GN=Mcu PE=3 SV=2
7	Q08BI9	6.90e-96	291	376	0.420	0.375	MCU_DANRE Calcium uniporter protein, mitochondrial OS=Danio rerio OX=7955 GN=mcu PE=1 SV=1
8	A0A0G2K059	5.69e-92	279	331	0.384	0.390	A0A0G2K059_RAT Calcium uniporter protein OS=Rattus norvegicus OX=10116 GN=Mcu PE=1 SV=2
9	Q8IQ70	7.27e-64	208	366	0.298	0.273	MCU_DROME Calcium uniporter protein, mitochondrial OS=Drosophila melanogaster OX=7227 GN=MCU PE=1 SV=2
10	Q21121	3.77e-58	192	333	0.277	0.279	MCU_CAEEL Calcium uniporter protein, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=mcu-1 PE=1 SV=2
11	Q54LT0	4.15e-22	96.3	275	0.143	0.175	MCU_DICDI Calcium uniporter protein, mitochondrial OS=Dictyostelium discoideum OX=44689 GN=DDB0186972 PE=1 SV=1
12	F4I111	8.87e-19	87.0	292	0.146	0.168	MCU6_ARATH Calcium uniporter protein 6, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At1g09575 PE=2 SV=1
13	Q1PE15	1.23e-12	70.1	338	0.098	0.098	MCU1_ARATH Calcium uniporter protein 1, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At4g36820 PE=2 SV=1
14	Q9LVR5	5.95e-12	67.8	321	0.092	0.097	MCU3_ARATH Calcium uniporter protein 3, mitochondrial OS=Arabidopsis thaliana OX=3702 GN=At5g66650 PE=2 SV=1
15	Q38CK8	4.72e-09	58.5	254	0.077	0.102	Q38CK8_TRYB2 Calcium uniporter protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.100.0180 PE=3 SV=1
16	Q387B7	4.57e-06	50.1	307	0.080	0.088	Q387B7_TRYB2 Calcium uniporter protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.47.0014 PE=3 SV=1
17	Q7S4I4	3.68e-05	47.8	493	0.077	0.053	Q7S4I4_NEUCR Calcium uniporter protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) OX=367110 GN=NCU08166 PE=1 SV=1
18	E9DVV4	1.38e-04	45.8	484	0.086	0.060	E9DVV4_METAQ Calcium uniporter protein OS=Metarhizium acridum (strain CQMa 102) OX=655827 GN=MAC_01752 PE=1 SV=1
19	Q38C29	2.17e-04	44.3	214	0.089	0.140	Q38C29_TRYB2 Calcium uniporter protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.5600 PE=3 SV=1
20	Q55DA0	4.4	31.6	615	0.057	0.031	ABCGM_DICDI ABC transporter G family member 22 OS=Dictyostelium discoideum OX=44689 GN=abcG22 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04678 MCU	3e-65	231.1	Mitochondrial calcium uniporter

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000378145

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000354415	0.998	Calcium uptake protein 1, mitochondrial
2	9606.ENSP00000371811	0.997	Calcium uptake protein 2, mitochondrial
3	9606.ENSP00000327467	0.994	Essential MCU regulator, mitochondrial
4	9606.ENSP00000368468	0.965	Mitochondrial calcium uniporter regulator 1
5	9606.ENSP00000321455	0.957	Calcium uptake protein 3, mitochondrial
6	9606.ENSP00000362144	0.942	Calcium uniporter protein, mitochondrial
7	9606.ENSP00000301454	0.821	Calcium-binding mitochondrial carrier protein SCaMC-3
8	9606.ENSP00000447091	0.774	Mitochondrial sodium/calcium exchanger protein
9	9606.ENSP00000268704	0.740	Paraplegin
10	9606.ENSP00000269143	0.728	AFG3-like protein 2
11	9606.ENSP00000305653	0.721	Mitochondrial proton/calcium exchanger protein
12	9606.ENSP00000271640	0.701	Histone-lysine N-methyltransferase SETDB1
13	9606.ENSP00000479488	0.681	Prohibitin
14	9606.ENSP00000441875	0.676	Prohibitin-2
15	9606.ENSP00000378265	0.651	Sodium/hydrogen exchanger 9B2
16	9606.ENSP00000295079	0.650	m-AAA protease-interacting protein 1, mitochondrial
17	9606.ENSP00000377390	0.647	Serine/threonine-protein phosphatase 6 regulatory subunit 3
18	9606.ENSP00000281146	0.578	UPF0462 protein C4orf33
19	9606.ENSP00000322649	0.524	Solute carrier family 25 member 41
20	9606.ENSP00000386772	0.508	G-patch domain containing 11

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.997	protein binding
GO:0022857	0.873	transmembrane transporter activity
GO:0016247	0.854	channel regulator activity
GO:0042802	0.853	identical protein binding
GO:0015075	0.700	monoatomic ion transmembrane transporter activity
GO:0008324	0.668	monoatomic cation transmembrane transporter activity
GO:0016248	0.581	channel inhibitor activity
GO:0005246	0.579	calcium channel regulator activity
GO:1901702	0.574	salt transmembrane transporter activity
GO:0022890	0.570	inorganic cation transmembrane transporter activity
GO:0008200	0.542	ion channel inhibitor activity
GO:0019855	0.447	calcium channel inhibitor activity
GO:0015291	0.427	secondary active transmembrane transporter activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0006810	0.990	transport
GO:0071702	0.970	organic substance transport
GO:0051560	0.965	mitochondrial calcium ion homeostasis
GO:1990542	0.946	mitochondrial transmembrane transport
GO:0098662	0.946	inorganic cation transmembrane transport
GO:0098655	0.946	monoatomic cation transmembrane transport
GO:0070588	0.944	calcium ion transmembrane transport
GO:0006851	0.481	mitochondrial calcium ion transmembrane transport
GO:0065007	0.342	biological regulation
GO:0050789	0.329	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005743	0.999	mitochondrial inner membrane
GO:0070013	0.998	intracellular organelle lumen
GO:0032991	0.997	protein-containing complex
GO:0031981	0.994	nuclear lumen
GO:0034703	0.991	cation channel complex
GO:0005654	0.970	nucleoplasm
GO:0034704	0.957	calcium channel complex
GO:0098798	0.878	mitochondrial protein-containing complex
GO:0098800	0.860	inner mitochondrial membrane protein complex
GO:1990246	0.344	uniplex complex
GO:0071944	0.301	cell periphery

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]